KEGG   Granulicella tundricola: AciX9_2742Help
Entry
AciX9_2742        CDS       T01411                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
acm  Granulicella tundricola
Pathway
acm00010  Glycolysis / Gluconeogenesis
acm00620  Pyruvate metabolism
acm00640  Propanoate metabolism
acm00680  Methane metabolism
acm01100  Metabolic pathways
acm01110  Biosynthesis of secondary metabolites
acm01120  Microbial metabolism in diverse environments
acm01130  Biosynthesis of antibiotics
acm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX9_2742
   00620 Pyruvate metabolism
    AciX9_2742
   00640 Propanoate metabolism
    AciX9_2742
  Energy metabolism
   00680 Methane metabolism
    AciX9_2742
Enzymes [BR:acm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AciX9_2742
Lipid biosynthesis proteins [BR:acm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AciX9_2742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADW69766
UniProt: E8WXS1
Position
complement(3198859..3200847)
Genome map
AA seq 662 aa AA seqDB search
MSSSSNSATESTTVHTNMHSFLREDRVFAPPAEFAAKAHVTSLDDYEAMYKRSVDDPEGF
WSDAANELEWFTPFTSVVQGEMGSARWFEGGRLNLCHNCVDRHALGVRRDKVAIVWEGEP
GEVKRLTYGDLLEQVQVFGNVLKSLGVKKGDRVAIYMGMCPELAIALLACARVGAVHNVI
FGGFAAHALVDRINDSECKVVLTQDTSYRRGGEVKLKAIVDEALEKCPGVESVLVHRRSG
TAVAMKEGRDLWLDEESAKFAGQACVAEAMESEDPLYILYTSGTTGKPKGLVHTTGGYSV
GTYLTSKYNFDLREEDVYWCTADIGWVTGHSYVVYGPLQNGATVLMYEGAPNHPQPDRFW
KLIDDHKVTVFYTAPTAIRSFIKWGGEWLKPYSLASLRLLGTVGEPINPESWMWYYREIG
HEKCPIVDTWWQTETGAHMIAPVPGAVATKPGSATRPFFGIVPEIVTKEGEPVPAGQGGL
LVIRKPWPSMARTIYGDAERYKQAYFSEIPGAYFTGDGARCDADGYYWLMGRVDDVINVS
GHRLGTMEIESALVAHPKVAEAAVVGRPDEMKGQAISAFVSLEEGHEPSDELKNELRQWV
AKEIGALARPDDLRFTQSLPKTRSGKIMRRLLRELATTGTVTGDTTTLEDFNVIASLRGN
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagctccagcaacagcgccacggaaagcaccaccgttcacacgaatatgcactcg
tttctgcgggaagaccgcgtctttgcaccgcctgcggagtttgcggcgaaggcccatgta
acgtcgctggacgactatgaggcgatgtacaagcggagcgtcgacgatcctgaaggcttc
tggagcgacgctgcgaacgaactggagtggtttacgccgtttacctccgtggttcaaggt
gagatggggtcggcgcgttggtttgagggtgggcggctgaatctttgccacaactgtgtg
gatcgtcatgcgttgggggtgcggcgggataaggtcgccatcgtgtgggagggtgagccg
ggtgaggtaaaacggctgacgtatggcgacctgctggagcaggtacaggtgttcgggaat
gtgctgaagtcgctgggtgtgaagaagggcgaccgcgtggcgatctacatggggatgtgc
ccggagcttgcgattgcgctgctggcctgtgcgcgtgtgggggcggtgcataacgtgatc
ttcggtgggtttgcggcgcatgcgctggtagaccggatcaacgactcggagtgcaaggtg
gtgctgacgcaggatacgtcgtaccggcgcgggggcgaggtcaagctgaaggccatcgtg
gatgaggcgctggagaagtgcccgggtgtggagagcgtgctggtgcatcggcgcagcggg
accgcggtggcgatgaaggaagggcgcgacctctggctggatgaggagagtgcgaagttt
gcggggcaggcttgcgtggcggaggcgatggagtcggaagatccgctctacatcctctac
acgtccgggacgacgggcaagccgaaggggctggtgcatacgacgggtgggtactccgtg
gggacgtatctgacgagcaagtacaacttcgacctgcgggaagaggatgtgtactggtgt
acggcggatatcggatgggtgacggggcatagctacgtggtctatgggccgctgcagaat
ggcgctacggtgctgatgtatgagggtgcgccaaatcatccgcagccggaccggttctgg
aagctgatcgacgatcacaaggtgacggtgttctacacggctccgacggcgatccggtcg
ttcatcaagtggggcggcgagtggttgaagccgtactcactggcttcgctgcggctgctg
gggacggtgggtgagccgatcaatcctgagtcttggatgtggtattaccgggagattggg
catgagaaatgccccatcgtcgatacatggtggcagacggagacgggtgctcacatgatc
gcgccggtgccgggcgcggtggcgacgaagccgggatcggcgacgcggcctttctttggg
attgtgcctgagattgttacaaaagaaggcgagccggtgcctgcggggcagggcgggttg
ctggtgatccgcaagccttggccctcgatggcacggacgatctatggagatgcggagcgg
tacaagcaggcttacttctctgagattccgggggcgtacttcaccggcgacggcgcgcga
tgcgatgcggatggatactactggctgatggggcgcgtggacgacgtgatcaacgtcagc
gggcatcggctggggacgatggagatcgagtccgcgctggtggcacatcccaaggtggcc
gaggctgcggtcgtcgggcggccggatgagatgaaggggcaggcgatctctgcgttcgtg
tcgcttgaggagggccatgagccatcggatgagttgaagaacgaactgcggcagtgggtg
gcgaaggagatcggtgcgctggcgcggccggatgacctgcggttcacgcagtcgctgccg
aagacgcggtccggcaagatcatgcggcgtctgctgcgggagcttgcgacgaccgggacg
gtgacgggggatacgacgacgctggaagacttcaatgtaattgctagtcttcgggggaac
gaggagtaa

DBGET integrated database retrieval system