KEGG   Granulicella tundricola: AciX9_4000
Entry
AciX9_4000        CDS       T01411                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11897  type VI secretion system protein ImpF
Organism
acm  Granulicella tundricola
Brite
KEGG Orthology (KO) [BR:acm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acm02044]
    AciX9_4000
Secretion system [BR:acm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AciX9_4000
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ADW70796
UniProt: E8X5R2
Position
pACIX901:complement(16364..16825)
AA seq 153 aa
MAKSKAENLVTQSLLDRLCDVDDWPTTRQQSMRVYRESIKRDVEYLLNSRRPPIEDINLY
PRAAASVINYGLPDIHSYSESAGDQSALMTAMLQTLRRFEPRIQGVRVFVSRGEAMTRSL
QFRIEGRIQFDTQVENIEFDTVLELTRGEYEVK
NT seq 462 nt   +upstreamnt  +downstreamnt
gtggccaagagcaaagcagaaaatctcgtaacgcaatcgctgctggaccggctgtgcgat
gtggatgactggcctacgacgcggcagcagtctatgcgagtttatcgtgaatcgatcaag
cgggatgtggagtatctgctgaactcgcggaggccaccgattgaggatatcaacctctat
ccgagggcggcggcttcagtgatcaattatgggttgccggatattcattcgtattcagag
tccgccggagaccagagcgcactgatgacggcgatgctacagacgttgcggagatttgag
ccgagaattcagggcgtgcgggtgtttgtttcgcgcggggaggcgatgacgcggagtctt
cagtttcggattgaggggcgcattcagttcgacacgcaggttgagaatatcgagttcgac
acggtgctggagttgacgcgcggtgagtatgaggtgaagtag

DBGET integrated database retrieval system