KEGG   Granulicella tundricola: AciX9_4004
Entry
AciX9_4004        CDS       T01411                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
acm  Granulicella tundricola
Brite
KEGG Orthology (KO) [BR:acm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acm02044]
    AciX9_4004
Secretion system [BR:acm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AciX9_4004
SSDB
Motif
Pfam: VipB VipB_2 DUF3386 TssC Peptidase_S15 Spatacsin_C
Other DBs
NCBI-ProteinID: ADW70800
UniProt: E8X5R6
Position
pACIX901:complement(19998..21491)
AA seq 497 aa
MSSAANPLASASTAEAVETGEPSLLDQIVAQGRFSREAGDLERGKDLVKEFVSQVLEGQM
TLSKDAEATISARIAQLDRLISIQLNEVIHHPSFQKLEATWRGIKYLMDQSETNDMLKIK
VLNASKKDLLRDLQRAPEFDQSALFKKVYEEEFGVFGGAPFAAMVGDYEFGRGPEDLELL
EKIGQVASAAHAPFLSAAAPGLMNLSDYTQLGAPRDMSKIFDSTEYAKWKSFRQSDDSRY
VALTLPHILMRQPYGQDTKQIEAFAYEEAVDGRDHSKYLWGNAAFGLAARMTNSFARSGW
CSAIRGVEGGGLVEGLTAHNFTTDEGDVALKCPTEVTITDRREKELADQGFVPLVHCKGT
DKAAFFSVQTVNKPKLYDKPEANANARLSAQLPYIMAMSRFAHYLKAMMRDKIGSAMSRV
EAEKFLNQWVNQYVLADDTGSAAAKAKRPLREARIEVMSVPGNAGALRAVAFMRPHFQLD
ELTVSLRLVADLPAPAK
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgagtagtgcagcgaacccgctggcgagcgccagcaccgcagaagcagtcgagacgggc
gagccttcccttcttgatcagatcgtcgcgcagggccgtttcagccgcgaggctggcgat
ctagagcgaggcaaagatctggtgaaggagttcgtcagccaggtgctcgaaggacagatg
acgttgagcaaggatgccgaggcgacgatcagcgcacgcatcgcgcagcttgaccgtctg
atctcgatccagttgaacgaggtgattcatcacccttcgttccagaagctggaagcgacg
tggcgcggcatcaagtacctgatggatcagagcgagacgaacgacatgctcaagatcaag
gtgctgaacgcgtccaagaaagacctgctgcgcgatcttcagcgtgcaccggagttcgat
cagagcgccttattcaagaaggtctacgaagaggagttcggcgtattcggcggcgctccg
ttcgcggcgatggtcggcgattacgagtttggccgtggtcctgaagatctggagctgctc
gagaagatcgggcaggtcgcatccgcggcgcatgctccgttcctttccgctgccgctcct
ggcttgatgaacctgagcgactacacacagctcggcgctccacgcgatatgtcgaagatc
ttcgacagcaccgagtatgcgaagtggaagtcgttccgtcagtccgacgactcccgctac
gttgcgttgacgcttccgcacatcctgatgcgccagccgtacgggcaggatacgaagcag
atcgaagcgtttgcgtatgaggaagcggtggacggccgcgaccactcgaagtatctgtgg
ggcaatgcggcgttcggcctggctgcacgcatgacgaactcgtttgcgcggtccggctgg
tgctcggcgatccgcggcgtggaaggcgggggcctggtcgaaggactgacggcccataac
ttcacgaccgacgagggcgatgtcgcgctgaagtgtccgaccgaggtgacgatcaccgac
cgtcgtgaaaaagagcttgccgatcagggttttgttcccctggttcattgcaaggggacg
gacaaggccgcgttcttcagcgtccagaccgtcaacaagccgaagctgtacgacaagccg
gaggcgaatgccaatgcccggctttcggcccagcttccgtacatcatggcgatgtctcgt
ttcgcacattacctcaaggcgatgatgcgcgataagatcggcagcgcgatgagccgtgtc
gaggcagagaagttcctaaatcagtgggtcaaccagtacgtgcttgcggatgacacagga
tctgcggcggcaaaggcaaaacggcctttacgcgaggctcgtattgaggtcatgtcggtt
cctggaaatgcgggtgcgctgcgcgcagtcgcgtttatgcggccgcatttccaactggat
gagttgaccgtttctctgaggctggtggcggatctgccggctcccgcgaagtaa

DBGET integrated database retrieval system