KEGG   Granulicella tundricola: AciX9_4010
Entry
AciX9_4010        CDS       T01411                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
acm  Granulicella tundricola
Pathway
acm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AciX9_4010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acm02044]
    AciX9_4010
Secretion system [BR:acm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AciX9_4010
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ADW70806
UniProt: E8X5S2
Position
pACIX901:30012..30746
AA seq 244 aa
MSTAATIPQAPPAARTNSLALSFQDVITVVLRMRYGAQRIPDAAAFRVSIRKMIAASVQE
VRSLGYSDATSHMALYAIIGFLDESVLNSQDPVFADWSRRPLQEEMFGGHFAGETFFRQV
ADLLNAPESTEVADTLELHAICLLLGYRGKYAFGEGGEISGILSRIRDKIIRIRGPLALA
RLSAVPEVKIVAKRDKWLTSLYLAAACLIVLTIVLFAVYTLTLGSGLGSIRSAALFTPFT
RLSL
NT seq 735 nt   +upstreamnt  +downstreamnt
atgagcaccgccgccactattccgcaggccccacccgccgcccgcaccaactcactcgcc
ctctccttccaggacgtcatcaccgtcgtcctccgcatgcgttacggagcccagcgaatc
cccgacgccgcagccttccgcgtctctatccgcaagatgatcgcggcctccgtccaggag
gtccgctctctcggttactccgatgccaccagccacatggccctctacgccatcatcggt
ttcctcgatgaaagtgtcctcaactcccaggaccccgtcttcgccgattggtcccgccgc
cctctccaggaagagatgttcggcggccacttcgccggcgagaccttcttccgccaggtc
gcagacctcctcaacgcccccgaatccacggaagtcgccgacaccctcgagctccacgcc
atctgcctcctccttggctatcgtggcaagtacgccttcggcgaaggcggcgagataagc
ggtattctgtcccgcatccgcgacaagatcatccgcatccgtggcccgctcgccctcgcc
cgcctcagtgccgtaccagaggtcaaaatcgtcgccaaacgcgataagtggctcacctcc
ctgtatctcgccgccgcctgcctcatcgtgttgaccatcgtgctcttcgccgtctacacc
ctcaccctcggctccggcctcggcagcattcgcagcgctgccctcttcactccctttacg
aggctctccctgtga

DBGET integrated database retrieval system