KEGG   Anaplasma centrale: ACIS_00275Help
Entry
ACIS_00275        CDS       T01133                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acn  Anaplasma centrale
Pathway
acn00020  Citrate cycle (TCA cycle)
acn00310  Lysine degradation
acn01100  Metabolic pathways
acn01110  Biosynthesis of secondary metabolites
acn01120  Microbial metabolism in diverse environments
acn01130  Biosynthesis of antibiotics
acn01200  Carbon metabolism
Module
acn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACIS_00275
  Amino acid metabolism
   00310 Lysine degradation
    ACIS_00275
Enzymes [BR:acn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ACIS_00275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACZ48945
UniProt: D1ATR7
Position
252238..253482
Genome map
AA seq 414 aa AA seqDB search
MSDNVEIKVDNLGGESISEAPVRVLKRVGDAVSAEEAVFVIETDKTSLEIASPVAGVITE
LRVSDEEIITRGQVLAIISKHEGAPQDAAAREHKQAEVAAPDAELAPQVEQRDVQVQVAD
KEKPVKPATGPRIPGIDEFVAGGCSSPADRAAGKITKPVGDVGKSPVPQQRVYDEVDGII
SVPGERRVKMSKIRQVIASRLKESQNTAATLSTFNEVDMSAVMALRGKYKEGFEKKYEVK
LGFMSFFIRAVVLALREIPVINAEISGDEIIYRDYCNIGVAVGTDKGLVVPVIRGAETMS
FAALEQELVMLSKKARGGTLTVADMSGATFTITNGGVYGSLLSTPIINPPQSGILGMHAI
QERPVVVNGNIEIRPMMYLALSYDHRIVDGQGAVTFLVRVKQYIEDPNRMSLEI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataatgtagagataaaagttgataaccttggtggggaatccatatcagaggcc
cctgttcgggttctgaaaagggttggtgatgccgtttccgcagaagaggcggtttttgtt
attgaaacggataaaacctctctggagatagcgtctccggttgccggtgttatcaccgaa
ctgcgcgtgtcggacgaagagataataaccaggggccaggttttggcgatcatcagcaag
catgaaggtgcccctcaggatgccgcagcgcgtgagcacaagcaagctgaagttgcagct
ccggatgccgaattagcaccgcaggttgagcaacgtgatgtgcaagttcaagttgctgac
aaggaaaagccggttaagccagccactggcccacgcattcccggtatagacgagttcgtt
gccggtgggtgttcctcacctgctgatagggcggctggtaaaatcaccaagcctgtgggc
gatgtgggcaagagccccgtcccgcagcaacgcgtgtatgatgaggttgacggcatcata
agcgtgccaggggaaaggcgcgttaagatgagcaaaatccgccaggtgatcgcgtcacgg
ctgaaggaatcgcaaaacaccgcagccacgctcagcacttttaatgaggtggatatgagt
gctgttatggcgctcagggggaaatataaggaaggctttgagaagaagtatgaggtgaaa
ctggggttcatgtcgttcttcatcagggccgtggtgctggctctcagagagataccggtg
attaatgctgagatttccggggatgagataatataccgtgactactgcaacatcggggtc
gcggttggcacggataaggggttagtagttccggtgatacgcggggccgagacaatgtcg
tttgcggcgttagagcaagagttggtaatgctgagtaaaaaggccaggggagggacgctc
acagttgctgatatgtctggcgcaacgtttaccatcaccaatgggggggtgtatgggtct
cttctttccacaccgattatcaaccctcctcagtcagggattctgggcatgcatgcaata
caagagcgccccgtggtggtcaacggcaatattgaaatcaggcccatgatgtatctcgcg
ctttcgtatgaccacagaatagtggatggtcaaggtgcggtgaccttcctcgtgcgcgtc
aagcaatatatagaagatccgaacaggatgtctctcgagatttag

DBGET integrated database retrieval system