KEGG   Anaplasma centrale: ACIS_00319Help
Entry
ACIS_00319        CDS       T01133                                 

Gene name
apaG
Definition
(GenBank) putative ApaG protein
  KO
K06195  ApaG protein
Organism
acn  Anaplasma centrale
Brite
KEGG Orthology (KO) [BR:acn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ACIS_00319 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ACZ48974
UniProt: D1ATU6
Position
301208..301648
Genome map
AA seq 146 aa AA seqDB search
MFFEVVGWCCAMTTPRCSGATGLIEVEVTPSYLEEHSMPHENCYIWLYSVRIKNVSDSTV
QLLKRSWKIIDSKGMINEVSGSGVVGRQPVLKPGGFFEYTSGTCLSTPSGVMNGWYQFVD
EDKAQVFYVDVPTFSLDSPYDIVRLN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttcgaagttgtggggtggtgctgcgctatgacgacgcctagatgtagtggtgcg
actggtctgatagaagttgaggtaacaccgagctacctcgaggagcattcgatgccgcac
gagaattgctacatatggctttacagcgtcaggatcaagaatgtcagtgattctactgta
cagctgttgaagcgtagctggaagataatagattctaaaggcatgataaacgaagtcagc
gggtctggtgtggtgggccgtcagcccgtgctaaagcccggggggtttttcgagtacact
agtggtacgtgcctcagtacgccgtccggggttatgaacgggtggtatcaattcgtggat
gaagacaaggcgcaggtcttctatgtggacgtgcctactttctcgcttgatagcccttat
gatatcgtaaggcttaactag

DBGET integrated database retrieval system