KEGG   Aminobacterium colombiense: Amico_0001Help
Entry
Amico_0001        CDS       T01202                                 

Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
aco  Aminobacterium colombiense
Pathway
aco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Amico_0001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aco03032]
    Amico_0001
   03036 Chromosome and associated proteins [BR:aco03036]
    Amico_0001
DNA replication proteins [BR:aco03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Amico_0001
Chromosome and associated proteins [BR:aco03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Amico_0001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C IstB_IS21 DnaA_N AAA RNA_helicase AFG1_ATPase ATPase_2 AAA_24 DNA_pol3_a_NII ATP-synt_ab DNA_pol3_delta
Motif
Other DBs
NCBI-ProteinID: ADE56150
UniProt: D5EC68
Position
141..1469
Genome map
AA seq 442 aa AA seqDB search
MVDKDINVLWDDILKNIEETMPEGTADLWLKTCVPLSVMNDVLVIDVPNVFVKEQISKRF
QNVIEDVLMDKGYAQSLELKVASEARKDEQQRAERAAQHTGTLPRSGLNPNYIFNSFVVG
KSNRLAHAASLAVAETPGEAYNPLFIWGGVGLGKTHLMHAIGHYVLNKNNSLKVTYVSSE
KFINEFIQSIKNNRTQEFKSKYRSVDILLIDDIQFLGNKGSSQEEFFHTFNQLHVSKKQI
VICSDRPPKEIQNIEDRLVSRFEWGLVTDIQMPDLETRIAILQKKAQIRNYEVPEDVISF
LAQNVPSNIRELEGALNRIIACAELNSEPITEENATQWLKDIIRHNSKGPVSVDTIQQIV
AENFSLTVEDLVGNRRTSDIALARQVAMYLCRKLTDISLQQIGFSFKKKDHTTVLHAQRK
ISKLVEEQPRMKEIVDNIEAKL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttggtggataaagatattaatgtactatgggatgacatcctaaagaacatcgaggagacg
atgccagagggaacagccgatttatggcttaagacatgtgttcccctttctgttatgaac
gatgtacttgttattgatgttcccaatgtttttgtaaaagaacagatctccaaacggttc
caaaatgtaattgaggatgttcttatggataagggatacgctcaatcactggagcttaaa
gttgcctccgaggcaagaaaggacgaacagcaaagagcagaacgagccgcccagcatacg
ggaactcttccccgaagcggccttaatcctaattatatcttcaatagttttgttgtggga
aaatcaaaccgtctcgcccatgctgccagtctggctgtagcagaaacgccgggagaagcc
tataaccctctttttatatggggaggcgtaggccttggcaaaacccacctgatgcacgca
atagggcattacgtgctcaataaaaacaattctttaaaagtaacctatgtgagctctgaa
aagtttatcaacgaatttattcaatccataaaaaataacaggacccaggaattcaaatct
aaatacagaagtgtggatatccttctcatcgatgacattcagtttcttggaaacaaagga
agcagccaagaagaattcttccacacctttaaccagcttcatgtaagtaaaaaacagatc
gtcatatgctctgaccgccctcctaaggagatccaaaacatagaggatcgtcttgtaagc
cgttttgaatggggattagtcactgatatacagatgcccgatcttgagacccgtattgcg
atccttcagaaaaaagcccaaattagaaattatgaggtgcctgaagacgttatctctttt
cttgcccagaatgtgcccagcaatataagagaactcgaaggagcccttaatagaatcatt
gcctgtgccgaactcaatagtgagcccattaccgaggaaaacgccactcaatggcttaaa
gatattattcgccataattcaaaagggcctgtaagtgtcgacactattcaacaaattgta
gcggaaaatttcagtttgaccgttgaagaccttgtagggaacaggcgcacatcagatatt
gcccttgcccgtcaggttgctatgtatctatgtcgaaaactcactgatataagtcttcag
cagataggcttttcttttaagaagaaagaccatactacagttctccatgctcagagaaaa
atatcaaaacttgtagaagaacaacctagaatgaaggaaattgtggataacatagaggct
aagctgtga

DBGET integrated database retrieval system