KEGG   Aminobacterium colombiense: Amico_0071Help
Entry
Amico_0071        CDS       T01202                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aco  Aminobacterium colombiense
Pathway
aco00260  Glycine, serine and threonine metabolism
aco01100  Metabolic pathways
aco01110  Biosynthesis of secondary metabolites
aco01120  Microbial metabolism in diverse environments
aco01230  Biosynthesis of amino acids
Module
aco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amico_0071
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Amico_0071
Enzymes [BR:aco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Amico_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DZR Zn_ribbon_SprT HypA
Motif
Other DBs
NCBI-ProteinID: ADE56219
UniProt: D5ECD7
Position
63054..64253
Genome map
AA seq 399 aa AA seqDB search
MLEKKLICTACGSTFSLRENLARCQKCREPLEIEEFISKNIDTEERSDIFKRYKSFFPFQ
SSCSGLSLGEGMTPLLSAPSFAEKYGVKEIFLKNETVNPTWSFKDRGTAASIHHAIELGF
RRIGTVSTGNMAASVAAFGARAGLETTILVKGDIPSEKLNPVAIYNARLIKALGDYDRLY
EESLRLGERYGIYFMNSDVPFRVEGSKTIAFEICEQTEFNVPDFVIIPTSAGGNIRGIEK
GFREFYKSGLIPHIPTIVAAQAEGCAPIARAYEKNSLTIERFPNPHTVAHAIENPFPPSG
NQVLRMLHRQRGVAVAVSEESIYESQLELAGMGLFVQPASAVSLAALKKLRQTGSISSEQ
RAACILTGSGLKYTAVFDAYNLNAEECLIDDLEKLLAVK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaaaagcttatatgcactgcctgcggatcaacgttttctcttcgagagaac
cttgcacgttgccaaaagtgcagggagccacttgagatcgaggagtttatttcaaagaat
atcgatacggaagaacgatcggacatcttcaaacggtataagagctttttcccctttcag
tccagttgcagcggtctttcccttggcgaaggaatgaccccccttctttcagctccctcc
tttgctgaaaaatacggggtgaaagaaatatttttaaagaacgaaacagtaaaccccacg
tggtcttttaaagaccggggaacagccgcgtccattcaccatgccattgaacttggtttt
cgccgaatcggaactgtctctacaggaaatatggcagcttccgtagctgctttcggggca
agagcaggccttgaaacgacaatccttgtgaagggggatatcccttctgaaaaactcaat
ccggttgccatctataatgcccgtctgatcaaggctctgggcgactatgaccgactttac
gaagaaagcctccgcctgggagaaagatatggcatctactttatgaattccgacgttccc
ttcagggtcgaagggtctaagaccattgcttttgaaatatgtgaacagacagagtttaat
gttcctgactttgttattataccaacaagtgccggcggcaacattcgaggcatagaaaaa
gggtttagagagttttacaaatccgggcttattcctcacataccaacgattgtcgcggct
caggcagaaggatgtgcaccaatagcgagagcctacgaaaagaattctctcactattgag
cggttccccaacccccacactgtcgcccacgccatagaaaaccctttccccccaagcggc
aaccaggtgttaagaatgcttcacaggcaaaggggggtagctgtggcagtttcagaagag
agcatttatgaatctcagctagaactggcagggatggggttgtttgttcagccagcttca
gctgtttcgctggcggcccttaaaaaactgcggcaaactggctctatctcttcagaacag
agagcggcatgtatccttacagggagcgggttgaaatacacagctgttttcgatgcctac
aatctcaatgccgaagagtgtcttatagatgatcttgagaagcttcttgcagtgaaatga

DBGET integrated database retrieval system