KEGG   Aminobacterium colombiense: Amico_0290Help
Entry
Amico_0290        CDS       T01202                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
aco  Aminobacterium colombiense
Pathway
aco00260  Glycine, serine and threonine metabolism
aco01100  Metabolic pathways
aco01110  Biosynthesis of secondary metabolites
aco01120  Microbial metabolism in diverse environments
aco01130  Biosynthesis of antibiotics
aco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amico_0290
Enzymes [BR:aco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Amico_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ADE56435
UniProt: D5ED03
Position
308537..309577
Genome map
AA seq 346 aa AA seqDB search
MYFPIDLKSDTVTKPSEEMRRAMYEAEVGDDVYSEDPTVLRLEEKAAEITGKEAALFAVS
GTMGNLVSLLSHCNRGDGVIIGTYSHINNYEGGGLSALGGLFPMLVDDSSGIPSPESIGE
KCLPKNVHYAPARLLCLENTHNKCGGIAVSPERFAETVEKAKDMGLPVHLDGARLFNAAL
AWGADISVYTSRVDSVQLCLSKGLGAPVGSVICASSDFIDRARHWRKRVGGGMRQAGVIA
AAGLYALDHNIDRMIEDHENAKRIAYILQDGGLAVEEKGRQTNMVFFSIPENGPTASTLI
DSCARRGVYFTAMGERRVRLVTHLDVSKEQAVKAAEIIVEEVKKPE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtactttcccatcgaccttaaaagcgataccgttacaaaacccagcgaggaaatgcgt
cgggcaatgtatgaggcagaagtaggagatgacgtttatagcgaggatccgaccgttctg
cggctggaagagaaagctgcagaaataacagggaaagaagccgctttgtttgcagtttcc
ggaaccatgggtaatcttgtttctctcctctcacattgtaatcggggagacggagtaatt
atcggaacctattctcacattaacaattacgaaggggggggcctttccgctcttggcggg
cttttccctatgcttgtggacgattcgtcaggaatcccttctccagaatcaattggtgaa
aagtgtcttcctaaaaatgtccactatgctcccgccaggcttctttgccttgaaaatacc
cacaataagtgcggaggcattgctgtttctccagaaaggttcgcagaaacagtagaaaag
gcaaaagatatgggtttgcctgttcaccttgacggagcaagactttttaacgcggcgtta
gcctggggagcagacatctctgtctatacatcccgtgtagattcggttcagctctgtctt
tccaaggggttaggggctcccgtaggaagtgttatctgtgcctcatctgattttatagac
cgcgcccggcattggagaaaacgagttggaggaggaatgcgtcaggcaggggtcattgcc
gcagcgggactctatgctttagatcataatatcgatagaatgattgaagatcatgagaat
gcgaaacgcatagcctatattcttcaggatggcggtttggccgttgaggagaagggcaga
caaacgaatatggtattcttttctattcccgaaaatggccccactgcatccacgcttata
gatagctgtgcccgtcggggagtttatttcacagccatgggagaacgccgtgtacgtctt
gttacccatcttgatgtgtcgaaggagcaggcagtgaaagccgcagaaatcatagtagaa
gaggtaaagaaaccagaatga

DBGET integrated database retrieval system