KEGG   Aminobacterium colombiense: Amico_0344Help
Entry
Amico_0344        CDS       T01202                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
aco  Aminobacterium colombiense
Pathway
aco00010  Glycolysis / Gluconeogenesis
aco00052  Galactose metabolism
aco00500  Starch and sucrose metabolism
aco00520  Amino sugar and nucleotide sugar metabolism
aco00521  Streptomycin biosynthesis
aco01100  Metabolic pathways
aco01110  Biosynthesis of secondary metabolites
aco01120  Microbial metabolism in diverse environments
aco01130  Biosynthesis of antibiotics
aco01200  Carbon metabolism
Module
aco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amico_0344
   00052 Galactose metabolism
    Amico_0344
   00500 Starch and sucrose metabolism
    Amico_0344
   00520 Amino sugar and nucleotide sugar metabolism
    Amico_0344
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Amico_0344
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Amico_0344
Enzymes [BR:aco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Amico_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADE56487
UniProt: D5ED55
Position
360474..361463
Genome map
AA seq 329 aa AA seqDB search
MHILTADIGGTTSRFALFSVRDKKVFLEKIIRKATARYASFFEILEEIRMEDGRFSFDEV
LFSVLALPGPVRKQDDIALTNVTWPIPIASLRRAYSQAPLLVVNDFIAQAYGCLTLHKGD
YFTVNEGQMDPEGHVAVIGAGTGLGCGVLVPYAFQKYAPLPSEGGHTTFAFLKEEQSFEV
FLRKRTSASYITKEMVVSGKGLSLLYEFLTGHSLTPLEVAEKISPSSLTAMLFATFYARA
CRDFALTVTPSRGLFISGGVAISNPWIVDNDIFKKEFTFSSSHSAFLNTIPVLLLKNVDN
GLWGAVHYGIHCLPEFEQTMGVEDSFSYL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgcatattctaactgcggatattggcggaactacaagtcgttttgcacttttttccgta
agggataagaaggtctttctcgaaaagattattcgaaaggcaacggccagatatgcgtct
ttctttgaaattttagaagagattcgtatggaagacggcagattttcctttgatgaagtg
ctgtttagtgtgcttgctcttcctggccctgtaagaaaacaagatgacatcgctttgacc
aatgtgacctggcccataccaatagcctctcttcgacgagcttatagtcaagcccctctt
ttggtagtaaatgattttattgcccaagcctatggttgcttaaccctccataagggggac
tatttcacagtcaatgaaggacagatggatccggaaggacatgttgcagtgataggggca
ggaacaggtctaggatgcggcgtgcttgttccatatgcttttcagaaatatgcccccctg
ccatctgaggggggccacacaacctttgcttttctcaaagaagagcagtctttcgaggtt
tttctcaggaaaaggacttcggcctcttacatcacaaaagaaatggtggtttccggaaaa
ggcctgtcccttctttatgagttcttaacgggacactctttaacccctctggaagtagcg
gaaaagataagtccgtcatctcttactgccatgctatttgctacattttatgccagagcc
tgcagggattttgctttaaccgtaaccccttccagaggactttttatctctggcggcgtg
gctatctccaatccatggatcgttgataacgatattttcaagaaagaattcactttttcc
tcttcccatagcgcctttctcaacactatcccggtgttgttgcttaaaaatgtcgataat
gggctctggggcgcagtacattatggcattcactgtttaccggagtttgagcaaactatg
ggagttgaagattctttttcatatttgtaa

DBGET integrated database retrieval system