KEGG   Aminobacterium colombiense: Amico_0526Help
Entry
Amico_0526        CDS       T01202                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aco  Aminobacterium colombiense
Pathway
aco00260  Glycine, serine and threonine metabolism
aco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aco01100  Metabolic pathways
aco01110  Biosynthesis of secondary metabolites
aco01130  Biosynthesis of antibiotics
aco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amico_0526
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amico_0526
Enzymes [BR:aco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amico_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADE56663
UniProt: D5EDN1
Position
complement(554204..555382)
Genome map
AA seq 392 aa AA seqDB search
MIQKNRKGYFGEYGGSFVPEALQVRLDELEEAYEEAKKDPSFSNEFITVLKEYVGRPSAL
TECKNISRHFGGGRLFLKREDLNHTGAHKINNALGQALLARRMGKNELIAETGAGMHGTA
SATVAALMGMKCTVYMGAVDVARQAPNVARMKVLGTEIVAVQDGQKTLKEAVDAALKAFA
EQPDTFYLLGSAVGPHPYPTMVRDFQSIIGKEARSQFLEREQKLPDYAIACVGGGSNAIG
LFSGFLDDSEVKIIGVEPAGKGLATGEHAATLSVGQPNIIHGFKSYVLSKENGEPAEVYS
ISAGLDYPGVGPEHAYLKDIGRVDYKSVTDEEAIDAFKLLSNKEGIIPALESSHALAYAF
KLLPALAKDQTVLVNLSGRGDKDMDTVLPLLV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgatacagaaaaacagaaaaggatattttggagagtacggcggcagtttcgttccggaa
gcacttcaagtacgccttgatgagcttgaggaagcatatgaagaggcaaaaaaagatcct
tcgttcagcaatgaattcattactgttctaaaggagtatgtggggaggccatcggcctta
acagagtgtaagaatatctcccgtcactttggaggaggccgtctgtttcttaaacgtgaa
gatctaaatcatacaggggcccataaaatcaacaatgccttaggacaggctcttctagct
cgccgcatgggtaaaaatgaactcatagcagaaacaggggctggaatgcatggcaccgcc
agtgccacagtggcagcccttatgggaatgaaatgcacagtctatatgggagccgtcgat
gtagcaagacaggcaccaaatgtggcacgaatgaaagttctcggaactgaaatagttgcc
gtgcaggatggacaaaagactctgaaagaagcagtagacgctgcattaaaagcctttgca
gaacagcctgatactttttatctgctcggttcggcagtgggaccccatccctaccccact
atggtccgtgattttcaaagtatcataggcaaagaagctcgctctcaattcttagagcgg
gaacaaaaactcccggattacgccattgcctgtgttggcggaggaagcaacgccatcggg
cttttcagtggattcctggatgactctgaagttaaaatcataggagtggaacctgctggg
aaaggccttgctaccggagaacatgccgcaactctttctgttggtcagccaaacattatc
catggttttaaaagctacgtcctttcaaaagaaaacggggaaccagccgaagtttattcc
atatcggcaggccttgattatccaggggtcggaccggagcatgcctatcttaaggatatt
ggacgggtagactataaatctgtgacagatgaagaagctatcgatgctttcaaactcctc
agcaataaggaaggaattattcctgccctagaaagctctcatgcccttgcctatgcattt
aaacttcttcctgcattggcgaaagaccagaccgtgcttgtaaacctttctggacgggga
gataaagatatggatactgtactacctcttttagtgtga

DBGET integrated database retrieval system