KEGG   Aminobacterium colombiense: Amico_0740Help
Entry
Amico_0740        CDS       T01202                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aco  Aminobacterium colombiense
Pathway
aco00040  Pentose and glucuronate interconversions
aco00052  Galactose metabolism
aco00500  Starch and sucrose metabolism
aco00520  Amino sugar and nucleotide sugar metabolism
aco01100  Metabolic pathways
aco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amico_0740
   00052 Galactose metabolism
    Amico_0740
   00500 Starch and sucrose metabolism
    Amico_0740
   00520 Amino sugar and nucleotide sugar metabolism
    Amico_0740
Enzymes [BR:aco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Amico_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADE56873
UniProt: D5EE91
Position
759874..760758
Genome map
AA seq 294 aa AA seqDB search
MQKQIVSKCLFPVAGLGTRFLPATKDVPKEMLPLVNRPILSYGVEEAIDAGCTEMVMISS
RSKRSIEDYFDRTWDLEKTLAERGKKELLNLIRQIPQMARFIFTRQAEPLGLGHAVLCGE
SLCGGDYFGVILPDDVMIAQPSVLAQLIEVHESLGGSVIALETVSDEDTSRYGIVEAERI
HARVFQVHNLVEKPVKGCAPSNLAIMGRYVLSPRIFSILKEVKPGAGGEIQLTDGLIQLA
KEEPLWGVVYKGRRLDCGTQKGWLQANVELALKDPSLRDIVLQVVEEYKKGEGK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcagatagtttctaaatgccttttcccagttgcagggttaggaacccgcttt
cttcctgccacgaaagacgttcctaaagaaatgctgcccctcgttaacaggcctatcctt
tcctatggggtggaagaagcaatagatgcgggctgtactgaaatggtcatgatttcaagt
cgatccaaacgttccatcgaagattattttgatcgaacttgggacttggaaaagacactg
gcagagcgaggtaaaaaggaacttttaaatcttattcgccaaattccccaaatggcccgc
tttatatttacgcggcaggccgaacctttggggcttggccatgcagtcctctgcggggaa
tctctatgcggtggtgactattttggcgttattcttcctgatgatgtaatgattgctcag
ccctcagtgctggctcaattaatagaggtacatgaaagtttgggaggtagtgttattgcc
ttagagacggtttcagatgaagacacctcccggtatggaatagttgaagctgagagaatt
catgcaagggtctttcaagttcacaatctggtagaaaaaccggtaaaggggtgcgctccc
agtaatttggctataatgggacgatatgtcctctctcctcgaatcttctccattcttaaa
gaggtaaaaccaggggcagggggagaaatacagctcaccgatggtcttatccagttagca
aaggaagagcctttatggggtgttgtttataaaggaaggagactggattgtggtacgcaa
aagggatggttgcaggcaaatgttgaattggccctgaaagatccgtctttacgtgatata
gtactgcaagttgtagaagagtataaaaagggggaaggtaaataa

DBGET integrated database retrieval system