KEGG   Aminobacterium colombiense: Amico_0817Help
Entry
Amico_0817        CDS       T01202                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
aco  Aminobacterium colombiense
Pathway
aco00471  D-Glutamine and D-glutamate metabolism
aco00550  Peptidoglycan biosynthesis
aco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Amico_0817
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Amico_0817
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aco01011]
    Amico_0817
Enzymes [BR:aco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Amico_0817
Peptidoglycan biosynthesis and degradation proteins [BR:aco01011]
 Precursor biosynthesis
  Amino acid ligase
   Amico_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C Pyr_redox_2 AdoHcyase_NAD 2-Hacid_dh_C Mur_ligase Pyr_redox Bac_chlorC CbiA DRTGG
Motif
Other DBs
NCBI-ProteinID: ADE56950
UniProt: D5EEG8
Position
854767..856140
Genome map
AA seq 457 aa AA seqDB search
MKESNQDIAGKKITILGAGVSGKGLAILAKTLGAHVFVTEKKDTLSPEVEEAFKLQDIQW
EVGGNSLRALDADCIVVSSGISPQASVVKKAQGRGIPVIGEIDFVAPHIKGKVIGVTGSN
GKSTTTMLIGHLLKKYGYKTAVAGNIGNPLSLHASQNLDFIVIELSSFQLYWAHLLKSHV
AIVTNLAPDHIDWHGSFTNYLKAKARLVRLQEPGHWAVVQNRDVDALQLSGKSAVASLYW
EGQEPVHKTDAYICMGEQEAWLSYNKKELLFDYRDVDLIGRHNLENLAMTASALILGGVP
CSNLTKQLSDFIPLPHRCTFVAEINGVRYIDDSKGTNVAASATALTSIHGPKVVILGGQG
KGEDYSPLAEAVKKEARVAIVLGAEKKPIVTALEGAGFARHIEVDSMEDAVKAAMALSLP
GETVLLSPACTSWDMYPSYKKRGEHFQHLVNKYGGLL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaagcaaccaggatatagccgggaaaaagattacaattcttggtgctggagta
agtggaaaggggcttgcgatattagcaaaaacccttggagcccatgtctttgtgacagaa
aaaaaggacactctttctcccgaagtagaagaggcttttaaattacaggacattcagtgg
gaagttggagggaatagcttaagagcactagatgcggattgtattgttgtcagttcaggt
atttctcctcaagcttccgtcgttaaaaaggctcagggtagaggaataccggtaattgga
gaaattgattttgttgctccccatataaaagggaaagttattggggtaacggggagtaat
ggaaaaagcacgaccacaatgcttattggtcatcttctgaaaaaatacggatacaagacg
gctgtggctggaaatatcggaaaccctctttctttgcatgccagtcagaatttggatttt
atagtgattgaattgagcagtttccaactttactgggcccatctcctaaaaagccacgta
gctatagtgactaatttggcacctgatcatatagattggcatggttctttcacgaattat
ttgaaagcaaaggcgcgtcttgtccgtttgcaggaaccggggcattgggccgtggttcaa
aacagagacgtcgacgctcttcaactctcgggcaaatcggctgttgcttctctttattgg
gaagggcaggagccggttcataagacagatgcctatatttgcatgggagaacaggaagcc
tggctttcctacaacaaaaaagaattactttttgattatagagatgtggatcttatcggg
cggcataaccttgaaaatttagctatgactgcttctgctctcattctcgggggcgttcct
tgttcgaaccttacaaaacaactttcggattttatacctcttcctcatcggtgcactttt
gtggctgaaattaatggcgttcgttatattgatgattcaaaagggacgaatgtggcggca
agtgcaactgccttaacttcaatacatggccccaaggttgttattcttggcggtcagggg
aaaggagaggattactctccccttgcggaagcggtaaaaaaagaagccagagtcgctatt
gttcttggggcagaaaagaagcctatcgttactgctcttgagggggcaggctttgcgcgg
catattgaagttgattccatggaagatgctgtgaaagcagcgatggctctttctcttcca
ggcgaaaccgtccttctttcgccagcgtgcacaagttgggatatgtaccccagttataag
aagaggggggaacatttccagcaccttgtcaataaatacggaggattgttgtga

DBGET integrated database retrieval system