KEGG   Aminobacterium colombiense: Amico_1535Help
Entry
Amico_1535        CDS       T01202                                 

Definition
(GenBank) Ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
aco  Aminobacterium colombiense
Pathway
aco00998  Biosynthesis of secondary metabolites - other antibiotics
aco00999  Biosynthesis of secondary metabolites - unclassified
aco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aco00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    Amico_1535
   00999 Biosynthesis of secondary metabolites - unclassified
    Amico_1535
Enzymes [BR:aco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     Amico_1535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH THF_DHG_CYH_C OTCace GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADE57652
UniProt: D5EGH0
Position
1565981..1567003
Genome map
AA seq 340 aa AA seqDB search
MTNKLEILFLSDKQVNELAANNMSEVMHDMERVLSLFDSGDAMCPDKAVMPWGKTIEDEN
TLGRLNAMPGYIGGEYDMAGIKWIGSSPQNYKIGLPRATVLVILNDPITKIPVAISDGTT
VSAKRTGAVGGIAVKYLSVKNATTMTIFGAGAQSRTQLEAALLARPSIKTVYINDVMFER
AETFANEMSEKYGVAVTAVKEPGEYCKKSDIIITVTIASEPIVHADWIKKGALMMNMADY
EFTDDCVRLADKIVVDNWKNIKHRKISTVALMYDRGLITDGDITAQIGEIINGKKPGREN
NNETIYFNAVGMGIEDIAVVTRAYRKALEQGVGTKVPYWE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaaacttgagatactttttttgagcgataaacaagtaaatgaactcgcagca
aacaacatgtcagaagtaatgcatgatatggaaagagttctttctctctttgacagcgga
gatgcgatgtgccctgacaaagccgtgatgccatggggaaagaccattgaggatgaaaac
actctaggcagacttaatgctatgcctggatatataggcggcgagtatgatatggctggc
atcaaatggattggaagcagccctcagaattacaagatcggactgccaagagcaacggtt
cttgtaatattgaatgatcctatcaccaagattcccgtcgctatttctgacggcaccaca
gtcagcgcgaaacgaacaggtgctgttggcggaattgccgtaaaatatctttcggttaaa
aatgcgaccacaatgaccatattcggtgccggcgcacagagcagaacacagctcgaggcg
gcattgctggctcgtccttccattaaaaccgtctatatcaatgacgtcatgtttgagcgc
gcagagacctttgccaacgagatgagcgaaaaatacggtgtggcagttaccgcggtaaag
gaacctggggaatactgtaaaaagagcgacattatcattacggtcaccatcgcctctgag
cccatcgttcatgcagactggatcaagaaaggcgcactgatgatgaacatggccgactac
gagtttaccgatgactgcgtaaggctggcagataaaatcgtcgtggataactggaagaac
ataaaacatcggaagatcagtactgtcgcccttatgtacgacagggggctcataaccgat
ggagatataactgcacaaatcggagagattattaacggtaaaaagcctgggcgcgaaaac
aataatgaaaccatctatttcaacgcagtgggtatgggaatagaggacatagccgtagtt
acccgtgcatacagaaaggctctggagcaaggtgttggcacgaaggttccttattgggaa
tag

DBGET integrated database retrieval system