KEGG   Azoarcus communis: CEW83_02195Help
Entry
CEW83_02195       CDS       T05456                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
acom  Azoarcus communis
Pathway
acom00860  Porphyrin and chlorophyll metabolism
acom01100  Metabolic pathways
acom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CEW83_02195 (hemN)
Enzymes [BR:acom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     CEW83_02195 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C Fer4_12
Motif
Other DBs
NCBI-ProteinID: AWI74178
UniProt: A0A2U8GL58
Position
448078..449469
Genome map
AA seq 463 aa AA seqDB search
MTSQTDLIFDPQLIRRFDINGPRYTSYPTADRFVEAFDAQALTDWLGKRAVGGVSRPLSL
YFHIPFCNTICYYCACNKIITKDHGRSAKYLNYLEKEIEMQAAALGGTRQVTQLHLGGGT
PTFLSHAEMHQLMDAVRKHFNLVPNGEYSIEVDPRKVDFDTVEMLANLGFNRMSVGVQDF
AEDVQIATNRVQSVEETKLVIDAARATGFKSISMDLIYGLPKQNVISFNRTLEQVLELSP
DRISLYSYAHLPGLFKPQRRIIPIDLPSADSKLQILQLAIRRLTDAGYVYIGMDHFAKPD
DELTVAQRQGRLHRNFQGYSTQAECDLLAFGVSAIGKIGPVYAQNVKTLDEYYDALDRDE
LPVLRGIELTADDLLRRSIIQALMCHFELSIESIEIAHLIKFHEYFADEIADLKEMEEAG
LVKIDKDWISVLPAGRLLVRGIAMFFDRYLRSDRERARYSRVI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccagacagacctaatctttgatccccagttgattcgacgattcgacatcaac
gggcctcgctatacgtcgtatcccaccgcagacaggtttgtggaggcattcgatgcacaa
gcactgacagactggctgggaaaacgtgccgttggcggtgtgagccgaccgctgtcatta
tacttccacatccccttttgtaacacgatctgctattactgcgcctgtaacaagatcatc
accaaggatcatggcaggtctgccaagtatctgaattacctggaaaaagagatcgaaatg
caggcggcggccctgggggggacacgtcaggtcacgcagttacatctcgggggtggaacg
ccgaccttcctctcgcacgcggagatgcatcagttgatggatgcggtccgcaagcacttc
aacctggtgccgaatggcgagtactcgatcgaggtcgatccgcgcaaggtggatttcgac
accgtcgaaatgctggccaacctcggcttcaatcgcatgagcgtcggcgtgcaggacttc
gccgaggacgtgcagattgcgaccaaccgcgtgcaaagcgtcgaagagacgaagctcgtc
atcgacgcggcgcgggcaaccggcttcaagtcgatcagcatggacctgatctatggtctg
cccaagcagaatgtgatcagcttcaaccgcacgctggagcaggtgctcgaactctcgccc
gatcgaatctcgctgtacagctacgcgcacctgccgggactgttcaagccccagcgcagg
atcattccgatcgacctgccgtcagcggactccaagcttcagattctgcagcttgccatc
cgtcgcctgaccgacgccggctacgtctatatcggcatggaccatttcgcgaagccggat
gacgaactgaccgtggcgcagcggcaggggcgcctgcaccgcaatttccagggctattcg
acccaggccgagtgcgacctgcttgccttcggtgtgtcggcgatcggcaagatcggtccg
gtctacgcgcagaacgtcaagacgctcgacgagtactacgatgccctcgatcgcgacgag
ctgcccgtactgcgcggcattgagctcaccgccgacgatctcctccggcgctcgatcatc
caggcgctgatgtgccatttcgagctgtcgatcgagtcgatcgagattgcacacctcatc
aagttccatgagtactttgctgacgagatcgccgacctcaaggaaatggaagaggctggg
ctggtgaagatcgacaaggactggatcagcgtgctgcccgcgggccgtctgctggtgcgc
gggattgcgatgttcttcgatcgctatctgcgctcggatcgcgagcgcgcccgttactcc
cgggtgatctga

DBGET integrated database retrieval system