KEGG   Azoarcus communis: CEW83_06495Help
Entry
CEW83_06495       CDS       T05456                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
acom  Azoarcus communis
Pathway
acom00010  Glycolysis / Gluconeogenesis
acom00053  Ascorbate and aldarate metabolism
acom00071  Fatty acid degradation
acom00280  Valine, leucine and isoleucine degradation
acom00310  Lysine degradation
acom00330  Arginine and proline metabolism
acom00340  Histidine metabolism
acom00380  Tryptophan metabolism
acom00410  beta-Alanine metabolism
acom00561  Glycerolipid metabolism
acom00620  Pyruvate metabolism
acom00625  Chloroalkane and chloroalkene degradation
acom00903  Limonene and pinene degradation
acom01100  Metabolic pathways
acom01110  Biosynthesis of secondary metabolites
acom01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEW83_06495
   00053 Ascorbate and aldarate metabolism
    CEW83_06495
   00620 Pyruvate metabolism
    CEW83_06495
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CEW83_06495
   00561 Glycerolipid metabolism
    CEW83_06495
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEW83_06495
   00310 Lysine degradation
    CEW83_06495
   00330 Arginine and proline metabolism
    CEW83_06495
   00340 Histidine metabolism
    CEW83_06495
   00380 Tryptophan metabolism
    CEW83_06495
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CEW83_06495
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CEW83_06495
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CEW83_06495
Enzymes [BR:acom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CEW83_06495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AWI74913
UniProt: A0A2U8GNZ8
Position
1427963..1429411
Genome map
AA seq 482 aa AA seqDB search
MKHAIASHWQNYIDGQWVDGERQLTVSNPATTQPLASIALAGIDEAEAALDAATHCAQNG
WLTSTRPAQRVQWLLRIAAEIRAVTDEGAWVLCQENGKTLRDARDEFVEAARYFEYYAGM
ADKIEGISVPLGNGYVDFTSYEPMGVSVQIVPWNFPVSICARSLAPALAAGNAVVVKSPE
LSPLGMCVLFRAIERAGLPRGAVNLLCGLGSEVGAHLVSSPKANQIVFTGSVPTGQSILA
AAARWATPSVMELGGKSAALVFPDADREQLLASVKSGIFFNAGQVCSAMSRLLVHRDIHD
EIVAAVAEMAQGLVSGPGEEDPDHTPLISAEQLARVQAICNDAIAEGAEAVVGGDRQSDR
AGHFMQPTVFAGVTPQMKVAQQEVFGPVLAVIPFDSEEEAIEIANGTPFGLVSGVFTQDI
NRALRLTRRLRSGQVFVNEWYAGGIETPFGGVGLSGFGREKGQEALYSYVRTKNVAIRIQ
QD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgcgatcgccagccattggcagaactacatcgacggtcaatgggtagatggt
gagcgtcagcttactgtctccaacccagcgaccacccagccacttgccagcatcgcactg
gcgggtatcgatgaggccgaagccgcgctcgacgcggccacgcattgcgcgcagaacggc
tggctgacttcgacacgccccgcgcagcgggtgcagtggttgctgcgtatcgcagccgaa
atccgagcagtcactgatgaaggcgcgtgggtactgtgccaggagaacggcaagaccctg
cgcgatgcgcgcgacgagttcgtcgaggccgcacgctacttcgagtactacgccggcatg
gccgacaagatcgaagggatctccgtgcccttgggtaacggctacgtcgacttcacgagc
tacgaaccgatgggggtctcggtacagatcgtgccgtggaacttcccggtttccatctgc
gcccgctcgctggcccctgccctggcggcagggaatgcggtggtggtgaagtcgccggag
ttgtcgccactcggaatgtgcgtgttgtttcgcgccatcgagcgtgccggcctgccgcga
ggcgcagtcaacctgttgtgtgggctgggcagtgaggtcggcgcgcatctggtgagcagc
cccaaggcaaaccagatcgtgtttaccggctcagtccccaccgggcagtcgattctcgcc
gcggcagcgcgctgggcaacgccgagcgtcatggaacttggcggcaagtcagctgcgttg
gtctttcctgatgccgaccgcgaacaactgcttgccagcgtgaagagtggcattttcttc
aacgccggtcaggtgtgctcagcgatgtcgcgcctgctggtccatcgcgacatccatgac
gagatcgtggcggcagtcgctgagatggctcaagggctggttagtggccccggagaagaa
gatcccgatcacacccccttgatcagcgccgagcagctggcgagggtccaggccatctgc
aacgacgccattgccgagggtgccgaagctgttgtgggcggcgatcgtcagagtgatcgt
gctggtcacttcatgcagccgacggtgtttgcaggcgtcacaccacagatgaaggtcgca
cagcaggaggtgtttggaccggtgctggcagtgatcccgttcgactccgaggaggaagcc
atcgagatcgcaaatggcacgccgttcggactggtctcgggcgtgtttacccaggacatc
aaccgggccctgcgactgacgcgccgcctgcgaagtggtcaggtgttcgtcaacgaatgg
tatgcgggcggaatcgaaacaccgtttggcggtgtcggtctgtcgggatttggtcgcgag
aaaggccaggaagccctgtacagctacgttcgcacgaagaacgtggcaatccgcatccag
caggactga

DBGET integrated database retrieval system