KEGG   Azoarcus communis: CEW83_08825Help
Entry
CEW83_08825       CDS       T05456                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
acom  Azoarcus communis
Pathway
acom00361  Chlorocyclohexane and chlorobenzene degradation
acom00625  Chloroalkane and chloroalkene degradation
acom01100  Metabolic pathways
acom01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CEW83_08825
   00361 Chlorocyclohexane and chlorobenzene degradation
    CEW83_08825
Enzymes [BR:acom01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     CEW83_08825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 HAD Put_Phosphatase
Motif
Other DBs
NCBI-ProteinID: AWI75304
UniProt: A0A2U8GP58
Position
1951948..1952637
Genome map
AA seq 229 aa AA seqDB search
MKTVRLDGVKACIFDAYGTLFDVSSVARGAETALGNKAQDVLELWRAKQLQYTWLRSLAG
HHADFWQVTGEALSFALSSFNLDRPDLKVQLMACYMSIPAYPEVSETLQRLKTGGMKLAI
LSNGSPAMLSAAVHHAGLSAFFDAVISVEEVGVYKPHPSVYALPERHLGVGADRSCFVSS
SSWDAFSAKASGCRVMWCNRFRQPPECLPSTPDGMIGDLSALPEIVLAP
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtcagactggatggcgtcaaagcctgcatcttcgatgcttatgggaccctg
ttcgacgtctccagtgtcgcccgcggggccgagaccgcgctcggcaacaaggcgcaggac
gtgcttgagctgtggcgtgcaaagcagctccagtacacctggctgcgcagtctcgccggt
caccatgcggacttctggcaggttaccggggaagcgctcagctttgcgttgtcgagcttc
aatctggaccgccccgatctcaaggtccagctcatggcctgctacatgagcatcccggcc
tacccggaagtgagcgaaaccctgcaacggctcaagaccggcggcatgaaactcgcgatc
ctgtccaatggctcgcccgccatgctgtcggcagcggttcaccatgcgggcctgagcgca
ttcttcgacgcagtcatatcggtcgaggaagtcggggtgtataagccgcacccgagcgtc
tacgccttgcccgaaaggcatctcggcgttggcgccgatcgcagctgtttcgtctcgtcc
agcagctgggacgcgttttcagcgaaggcttccggctgtcgggtgatgtggtgcaaccgt
ttcaggcagcccccggagtgcctgccatcgacgcccgacggcatgatcggggatctctca
gcgctcccggaaatcgtgcttgcgccctga

DBGET integrated database retrieval system