KEGG   Azoarcus communis: CEW83_12445Help
Entry
CEW83_12445       CDS       T05456                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
acom  Azoarcus communis
Pathway
acom00430  Taurine and hypotaurine metabolism
acom00620  Pyruvate metabolism
acom00640  Propanoate metabolism
acom00680  Methane metabolism
acom01100  Metabolic pathways
acom01120  Microbial metabolism in diverse environments
acom01200  Carbon metabolism
Module
acom_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEW83_12445
   00640 Propanoate metabolism
    CEW83_12445
  09102 Energy metabolism
   00680 Methane metabolism
    CEW83_12445
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CEW83_12445
Enzymes [BR:acom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CEW83_12445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AWI75925
UniProt: A0A2U8GTU4
Position
2719265..2720452
Genome map
AA seq 395 aa AA seqDB search
MKAVLVLNAGSSSLKFALFAIEPELAEHPALSGQIDGIGATPQFNAKSAAGERFEEAVPT
TSSSQREQHRDALTHLLDWLAAHNPALEIAAAGHRIVHGGDLFSEPVRLYGHIMLKLKKF
VPLAPLHQPHNLNAVQAISAMAPDIPQVGCFDTAFHRTQPAVAQAYALPRKISAEGVKRY
GFHGLSYDYVARQLPSVIGDKASGAVVIAHLGNGSSMCALRDGRSVASTMGFTAVEGLMM
GTRTGSLDPGVLLYLMDQKGMSSKDLTNLLYKESGLLGVSGISQDMRTLLASAAPEAMEA
VDLYCYRIARELGSLAAAAGGLDALVFTGGIGEHAAQVREKVAKLSGWIGVDIDPEANAA
HASRIDSPSSKVAVAVVPTNEEGMIARYTVDVLGL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtacttgttctcaatgcaggctcgagcagcctgaagtttgcactgtttgcc
atcgaacccgagctggccgaacaccccgccctgtcgggccagatcgacggcatcggcgcc
acgccgcagttcaatgcgaagagcgctgcaggcgagcgcttcgaggaggcggtcccgacc
acctcttcgagccagcgcgaacagcaccgcgacgcgctcacccatttgctcgactggctg
gcagcacacaaccccgcgcttgagattgccgccgcaggccaccgcatcgtgcatggcggc
gacctgttcagcgaacctgtgcgcctgtacggccacatcatgctcaagctcaagaagttc
gtgccgctcgcgccgctgcaccagccccacaacctgaatgcagtgcaggcgatttcagcc
atggcacccgacattccgcaggtggggtgcttcgacacggcttttcatcgcacccagccg
gcggtcgcacaggcctatgcgctgccgcgcaagatcagtgcagagggcgtcaagcgctac
ggctttcacggtctttcctacgactacgttgcgcgccagctgccatcggtgatcggcgac
aaggcctcgggcgccgtcgtcattgcccacctgggcaacggctcgtcgatgtgcgcgctg
cgcgacgggcgcagcgtcgcgtcgacaatgggattcaccgcggtcgaggggctgatgatg
ggcacgcgcaccggcagcctggaccccggcgtactgctctacctcatggatcagaaaggg
atgagctccaaggacctgaccaatctgctgtacaaggaatcggggctgctaggggtttcc
ggcatcagtcaggacatgcgtaccctgctcgcgtccgctgcgccggaggccatggaggcg
gtcgatctgtactgctaccggatcgcacgtgagctcggttcgctcgcggccgcagcgggt
ggtctggatgcgctggtcttcactggcggcattggtgagcacgcagcccaggtgcgcgaa
aaggtggcgaagctgtcgggctggatcggcgtagacatcgaccccgaggccaatgctgct
catgcgagccggatcgacagcccgtcgagcaaggtggccgtcgccgtggtgccgaccaac
gaagaaggcatgattgcccgctacacggtcgacgtactgggcctgtga

DBGET integrated database retrieval system