KEGG   Azoarcus communis: CEW83_16715Help
Entry
CEW83_16715       CDS       T05456                                 

Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
acom  Azoarcus communis
Pathway
acom00260  Glycine, serine and threonine metabolism
acom00630  Glyoxylate and dicarboxylate metabolism
acom00670  One carbon pool by folate
acom01100  Metabolic pathways
acom01110  Biosynthesis of secondary metabolites
acom01130  Biosynthesis of antibiotics
acom01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CEW83_16715
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CEW83_16715
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CEW83_16715
Enzymes [BR:acom01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CEW83_16715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T DUF1989 GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AWI76651
UniProt: A0A2U8GSU9
Position
3662752..3664647
Genome map
AA seq 631 aa AA seqDB search
MNDKAPPFIEEDPFLLQADAQPTLQQVFPEPLTVIRVGAASARAFELKAGQFIQVIDVEG
RQCSDVLAFDAAALAAGEEWGLDPTVTRTLAGSSYPMPGLHAKYFDARMQPLLETVQDTV
GRHDAFALACTAKYYEDQGFPGHANCSDNFNAVLEPMGVRPRAGWPAINFFYNTFIQPCG
SLGFAEPWSKAGDYVLLRALKDLVVAVSSCADDIDPANAWQPTDIEVRIYDAAHSFPRAM
AHRMTPDAPVRLTRPTAFAGVTETLTRDFIDYHGFWLPRSFVGHGTIAEYWACREKVAVM
DLTALRKFDITGPDAEALLQKVVTRDMRKLAVGQVVYTAVCHAHGGMMDDGTVFRLGRDV
FRFVCGEDTTGLWLKEQAAAAGFNVHVRDATDSLHNIAVQGPRSRELLAKILWTAPAQPG
IAELGWFRFMAARLGGPTGRPLVVSRTGYTGELGFELWCHPDDGTELWNVVAEAGAPLGL
VPLGFDALDMLRIEAGLAFAGQEFCDQTDPFEAGIGFTVALSKPDDFIGRAALEERKAHP
RRKLVGLAIDSNEAVHHGDGVYIGRARVGEITSAVRSPVLNAQVALARVDVACSELDTAL
QVGQLDGHRKRLAARVVAFPHYDPTKSRVRS
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaaggcaccgccgttcatcgaagaggaccccttcctgctgcaggcggacgca
cagcccaccctgcagcaggtctttcccgagccgctgacggtgatccgggtcggggcggcg
agcgcccgggccttcgaactgaaggccgggcagttcattcaggtcatcgatgtggagggg
cgtcagtgttcggatgtcctcgccttcgatgccgcagcgcttgccgccggtgaagagtgg
gggctggacccgacggtgacccgcaccctggcggggtcgtcctatcccatgcccggcctg
cacgcgaagtatttcgatgcgcgcatgcagcccctgcttgagaccgtgcaggataccgtg
gggcggcacgatgcctttgcccttgcctgcaccgcgaagtattacgaggaccagggcttt
cccggtcacgccaactgcagcgacaacttcaacgccgtgctcgagccgatgggcgttcgt
ccgcgcgcaggctggccggcgatcaactttttctacaacaccttcatccagccctgcggc
agcctcggctttgccgagccgtggtcgaaggcgggtgactacgtgctgctcagggcactc
aaggatctggtggtggcggtgtcgtcctgcgccgacgacatcgaccccgccaacgcctgg
cagccgaccgacatcgaggttcgcatctatgacgcggcccattcattccctcgcgcgatg
gcccaccgaatgactcccgacgctcctgtacgcctgacccgtcccacggcctttgccggc
gtgaccgaaacgctgacgcgggacttcatcgactatcatggcttctggctgccgcgcagc
ttcgtgggccacggcacgattgccgaatactgggcgtgccgcgagaaggtcgcggtgatg
gatctgaccgcgctgcgcaagttcgacatcaccggacccgatgccgaggccctgctgcag
aaggtggttacccgcgacatgcgcaagctggccgtgggtcaggtggtctataccgcggta
tgccacgctcacggcggcatgatggacgacggcacggtgttccgccttgggcgcgatgta
ttccgcttcgtgtgtggcgaggacacgaccggcctgtggctgaaggagcaggcagcggca
gcgggcttcaacgtgcatgtgcgcgatgccactgacagcctgcacaacattgcggtgcag
ggaccgcgcagccgcgagctgctggccaagatcctgtggaccgcaccggcgcagccgggt
atcgccgaactcggctggttccgcttcatggcggcgcgtctgggcgggccgactggtcgc
ccgctggtggtgtcccgcaccggctacaccggcgaactcggcttcgagctgtggtgtcac
cccgatgatggcacagagctgtggaatgtcgtggccgaggccggagcgccgctcggactg
gtgccgctcgggttcgatgcgcttgacatgttgcgcatcgaggccgggctggcttttgcc
ggtcaggagttctgcgatcagaccgatcccttcgaagccggcatcggctttaccgtggca
ctgtccaaacccgacgacttcatcggtcgggcggcactcgaagaacgcaaggcgcacccg
cggcgcaagctggtcgggctcgcgatcgacagcaacgaagcggtgcatcacggcgacggc
gtctatatcggtcgcgccagggtgggcgagatcaccagcgcggtgcgctctccggtgctc
aatgcacaggtcgcgctggcgcgggtggatgtcgcctgttccgagctcgatacggcgctg
caggtgggccagctcgacggccaccgcaagcgactcgctgcgcgcgtcgtggccttcccg
cactacgatccgactaagtccagggtgcgcagctag

DBGET integrated database retrieval system