KEGG   Azoarcus communis: CEW83_17940Help
Entry
CEW83_17940       CDS       T05456                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
acom  Azoarcus communis
Brite
KEGG Orthology (KO) [BR:acom00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CEW83_17940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AWI77810
UniProt: A0A2U8GWN8
Position
3928858..3929958
Genome map
AA seq 366 aa AA seqDB search
MLCTLHPLIIRHRCHFAAECVPVDLVLVITVCAVATVLLFDYTNGFHDAANVVATVIASR
AMSPAQAVLVVAVFEFLGPLLGGTAVANTIGGFVDLAGVPVMLSLGILLAGSIGAIGWNL
LTWWKGIPSSSSHALVGGLVGAVVSSAGVDHVVWGFSALADGHLSGVTKVLLALVLSPLL
GFLVGYLIHRFLSLLFRAARPTLNRHLRLSQYVTTAGLAFAHGANDAQKSMGILTLVLLL
GGFIPSFDVPLWVMLVCAIAMTAGVLTGGWRIVRTLGFAVYKVRPLHALDSQLTSATVIL
SASLVGAPVSTSHVVASSIMGIGASERPRSVRWGKAGEIVATWVITIPASAAAGAIVLLL
LRPLLD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctttgtaccctgcatccgcttatcatcaggcacagatgccattttgccgcggagtgt
gtgccggtggaccttgtcctcgtgattaccgtgtgcgccgttgcgaccgtcctgctgttc
gattacacgaatggctttcatgatgctgcaaacgtcgtcgccaccgtcattgcctcgcgt
gcgatgagcccggcgcaggccgtattggtggtcgcagtgttcgagtttctcggacccctg
ctcggggggacggcagtggccaacacgattggcggtttcgttgatcttgcgggcgtgccg
gtgatgctgtctctggggatcttgctggccgggtcgatcggcgccattgggtggaatctg
ctgacctggtggaaaggcatcccgtcctcttcatcccatgcgctggttggcggtcttgtt
ggcgcggttgtgagctcggcgggtgtcgatcacgtggtgtggggattttcggcgctggct
gacggccatctttcgggggtgaccaaggtcctgctggcgcttgtcctgtctccactgctt
ggttttctcgtcggctacctgatacaccgttttctgtccctgctgttccgcgcggcacga
ccgaccctcaaccgccatctgcggctgtcccagtatgtcaccaccgccggactggcgttc
gcacacggggcgaacgatgcccagaagagcatgggcattctcacgctggtccttttgctc
ggcggtttcattccgagcttcgacgtgccgctctgggtcatgctcgtgtgcgccatcgcg
atgacggcgggcgtgctgacggggggctggcgcatcgtgcgcacgctcgggtttgcggtg
tacaaggtgcgtccgctgcatgcactcgattcgcaactcacctcggccacggtcatcctc
tccgcctcgctcgtgggggcgccggtctccacaagccatgtcgttgccagttcgatcatg
gggatcggcgcatccgaacgtccgcgcagtgtgcgctggggcaaggcgggcgagatcgtc
gcgacctgggtgatcacgattccggcctcggcggcggccggtgccatcgtgctgctgctg
ttgcgccccttgcttgattga

DBGET integrated database retrieval system