KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0080Help
Entry
A2cp1_0080        CDS       T00833                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00071  Fatty acid degradation
acp00072  Synthesis and degradation of ketone bodies
acp00280  Valine, leucine and isoleucine degradation
acp00310  Lysine degradation
acp00362  Benzoate degradation
acp00380  Tryptophan metabolism
acp00620  Pyruvate metabolism
acp00630  Glyoxylate and dicarboxylate metabolism
acp00640  Propanoate metabolism
acp00650  Butanoate metabolism
acp00900  Terpenoid backbone biosynthesis
acp01100  Metabolic pathways
acp01110  Biosynthesis of secondary metabolites
acp01120  Microbial metabolism in diverse environments
acp01130  Biosynthesis of antibiotics
acp01200  Carbon metabolism
acp01212  Fatty acid metabolism
acp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A2cp1_0080
   00630 Glyoxylate and dicarboxylate metabolism
    A2cp1_0080
   00640 Propanoate metabolism
    A2cp1_0080
   00650 Butanoate metabolism
    A2cp1_0080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A2cp1_0080
   00072 Synthesis and degradation of ketone bodies
    A2cp1_0080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A2cp1_0080
   00310 Lysine degradation
    A2cp1_0080
   00380 Tryptophan metabolism
    A2cp1_0080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A2cp1_0080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A2cp1_0080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A2cp1_0080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acp04147]
    A2cp1_0080
Enzymes [BR:acp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A2cp1_0080
Exosome [BR:acp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A2cp1_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: ACL63439
UniProt: B8J7U7
Position
89592..90788
Genome map
AA seq 398 aa AA seqDB search
MNRAGQQDVVFLAAKRTPFGTFGGSLKDLSATDLAVHAAQAAIEQAGAPPADYGHVVVGN
VAQTSPDAIYLARHVGLRAGLPEGVPAVTVNRLCGSGFEAVIEAARLIHGGEAELVLAGG
TESMSQAPLVLRGTRFGHAFGKTPPLEDMLWSALTDTYAGMPMALTAEKLAERHGIGQDA
VDELAVSSQRRWAAADEAGRFREELAPVELRTRKGTVRFEKDEHPRPGTTLEGLRKLPKV
FKADGVIHAGAASGIADGAGMLVVASRAYAERRGLRPLGRLVNWGHAGVDPTVMGIGPVP
AVRNALARAGATLADLDLIEVNEAFAPQVLAVEQELGLPRDRTNVDGGAIALGHPLAASG
ARITMHLLYELRRRKARAGLGSACIGGGQGVAVILEPL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgggccggccagcaggacgtggtgttcctcgccgcgaagcggacgcccttcggg
acgttcggcggctccctgaaggacctcagcgcgaccgacctcgcggtccacgccgcgcag
gcggcgatcgagcaggcgggggcgccgcccgcggactacggccacgtggtggtcgggaac
gtggcccagacctcgccggacgcgatctacctggcgcgccacgtcgggctgcgcgccggc
ctccccgagggcgtgcccgcggtcaccgtgaaccgtctgtgcggctccggcttcgaggcg
gtcatcgaggcggcgcggctcatccacggcggggaggcggagctggtgctggccggcggc
accgagtcgatgagccaggcgccgctcgtgctgcgcgggacgcgcttcggccacgcgttc
ggcaagacgccgccgctcgaggacatgctctggtcggcgctcaccgacacctacgccggc
atgcccatggcgctcaccgccgagaagctggccgagcgccacgggatcgggcaggacgcg
gtggacgagctcgcggtgtcctcgcagcggcgctgggccgccgccgacgaggccgggcgc
ttccgcgaggagctggcgccggtggagctccggacgcgcaaggggacggtgcggttcgag
aaggacgagcacccgcgccccggcaccacgctggaggggctgcggaagctccccaaggtg
ttcaaggccgacggcgtcatccacgccggcgcggcgagcggtatcgccgacggcgccggg
atgctggtggtggcctcgcgcgcctacgcggagcggcgcgggctgcggccgctgggacgc
ctggtgaactggggccacgccggcgtggaccccaccgtgatgggcatcgggccggtgccg
gcggtccggaacgcgctggcccgcgccggcgccacgctcgccgatctcgacctgatcgag
gtgaacgaggcgttcgcgccgcaggtcctggcggtggagcaggagctggggctcccacgc
gaccgcaccaacgtggacggcggcgccatcgcgctcggccatccgctcgccgcgagcggg
gcccggatcaccatgcacctgctgtacgagctccgtcgccggaaggcccgggccggcctc
ggctcggcctgcatcggcggcggccagggcgtggcggtgatcctggagccgctgtag

DBGET integrated database retrieval system