KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0178Help
Entry
A2cp1_0178        CDS       T00833                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00010  Glycolysis / Gluconeogenesis
acp00030  Pentose phosphate pathway
acp00051  Fructose and mannose metabolism
acp00052  Galactose metabolism
acp00230  Purine metabolism
acp00500  Starch and sucrose metabolism
acp00520  Amino sugar and nucleotide sugar metabolism
acp00521  Streptomycin biosynthesis
acp01100  Metabolic pathways
acp01110  Biosynthesis of secondary metabolites
acp01120  Microbial metabolism in diverse environments
acp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A2cp1_0178
   00030 Pentose phosphate pathway
    A2cp1_0178
   00051 Fructose and mannose metabolism
    A2cp1_0178
   00052 Galactose metabolism
    A2cp1_0178
   00500 Starch and sucrose metabolism
    A2cp1_0178
   00520 Amino sugar and nucleotide sugar metabolism
    A2cp1_0178
  Nucleotide metabolism
   00230 Purine metabolism
    A2cp1_0178
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A2cp1_0178
Enzymes [BR:acp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     A2cp1_0178
    5.4.2.8  phosphomannomutase
     A2cp1_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ACL63537
UniProt: B8J8T9
Position
195494..196864
Genome map
AA seq 456 aa AA seqDB search
MAKLSPTIFREYDIRGLVDQDLPEEAVSLVGKALGTRIRGAGGKRAAVGWDARLSGPKFA
KAMIEALTSTGVDVVSLGVVPTPLTYFAAHTLDVDGICMITGSHNPPEYNGLKVGLGSAT
YYGEEIQALRREAEAGRFATGQGTVRAHDIVTPYREHVRQNLRLGKRRLKVVVDAGNGTG
GVVAVPLFEALGFEVVPLFIEMDGNFPNHHPDPTVEKNLEHLRRKVLETGADVGIAYDGD
ADRVGAVDEKGNVLWGDQIMILFSRALLAEEPGAAIVGEVKCSFTLYDDIAARGGRAIMW
KAGHSLIKAKMKEEHALLAGEMSGHIFFAHRWFGFDDGIYSSARLLELLTHTDLPMSALL
ADVPRTFSTPELRVDCPEEKKFEVVRRAQEFFAARYDAVTVDGVRVVFPDGWGLVRASNT
QPLLVLRFEAKTEARLAEIQALVRGKVDELLRELGA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctccccgaccatcttccgcgagtacgacatccgcgggctggtggaccag
gatctccccgaggaggcggtctcgctcgtcggcaaggcgctcggcacgcgcatccggggc
gcgggcgggaagcgtgccgcggtggggtgggacgcgcgcctctccgggccgaagttcgcg
aaggccatgatcgaggcgctcacctccaccggcgtggacgtggtgagcctcggggtggtg
ccgacgcccctgacctacttcgccgcccacacgctcgacgtggacggcatctgcatgatc
accggctcgcacaacccgccggagtacaacggcctcaaggtcgggctcggctcggccacc
tactacggcgaggagatccaggcgctgcgccgcgaggcggaggccgggcgcttcgccacg
ggccaggggaccgtccgcgcgcacgacatcgtcacgccctaccgcgagcacgtccggcag
aacctccggctcgggaagcgccggctgaaggtggtggtggacgccggcaacgggaccggc
ggcgtggtggcggtgccgctgttcgaggcgctcgggttcgaggtggtgccgctgttcatc
gagatggacggcaacttcccgaaccaccaccccgacccgaccgtggagaagaacctcgag
cacctgcggcgcaaggtgctggagaccggggcggacgtgggcatcgcctacgacggcgac
gccgaccgggtgggcgcggtggacgagaagggcaacgtgctctggggcgaccagatcatg
atcctgttctcccgggccctgctcgccgaggagccgggcgccgccatcgtgggcgaggtg
aagtgctccttcacgctctacgacgacatcgccgcccgcggcgggcgggccatcatgtgg
aaggccgggcacagcctcatcaaggcgaagatgaaggaggagcacgcgctcctcgccggc
gagatgagcggccacatcttcttcgcccaccgctggttcgggttcgacgacggcatctac
tcgtcggcgcggctgctcgagctgctcacccacaccgacctgccgatgtcggcgctgctc
gccgacgtgccgcggacgttctccacgcccgagctccgggtggactgccccgaggagaag
aagttcgaggtggtgcgccgcgcccaggagttcttcgccgcccgctacgacgcggtgacg
gtggacggcgtccgggtggtcttccccgacgggtggggcctggtgcgcgcctccaacacg
cagccgctgctggtcctgcgcttcgaggcgaagaccgaggcgcggctcgccgagatccag
gcgctggtgcgcggcaaggtcgacgagctgctgcgcgagctgggggcgtag

DBGET integrated database retrieval system