KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0829Help
Entry
A2cp1_0829        CDS       T00833                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Brite
Enzymes [BR:acp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     A2cp1_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_10 NAD_binding_4 3Beta_HSD NmrA GDP_Man_Dehyd RmlD_sub_bind Sacchrp_dh_NADP Polysacc_synt_2 KR adh_short NAD_binding_2 Glyco_transf_4 ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACL64181
UniProt: B8JDT6
Position
926673..927692
Genome map
AA seq 339 aa AA seqDB search
MNVLVTGGTGLVGGAVARALLARGHSVRLYARASSDAAALEAAGAEVARGELDDRPALRA
ALAGRDAVVHSAGVVGFGPGLEAALEAVNVRAVEAVLGAALDAGVSRAVLTSSTAVMGGT
AAPEVADEASAGNAEALGMPYFVSKLRGERAARALAARGLALVVVRPAYVLGPGDVHGSS
ASILLAFAQRRIPAYVEGGASFCDVRDVAEGHVAALERGRPGEAYVLAGHNLAMSEMIRR
ACAIAGVPPPPRVPVPLALGFAAVQELAARAAGRRPRTSRGLVRASALYTFASSAKAERE
LGYRVRPFEEMVRDTYRWAIATGRLRPDTPELKALNDGP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtcctcgtgaccggcggtacgggcctggtgggcggcgcggtggcgcgcgccctg
ctcgcgcgcgggcactcggtgcggctgtacgcccgcgcctccagcgacgccgccgcgctg
gaggcggccggcgcggaggtggcgcgcggcgagctggacgaccggccggcgctgcgcgcg
gcgctggcgggccgcgacgcggtggtccactcggcgggcgtggtgggcttcgggccgggg
ctggaggcggcgctcgaggcggtcaacgtgcgcgccgtcgaggcggtgctgggcgccgcg
ctggacgcgggggtgtcgcgcgccgtgctcacctcgtccacggcggtcatgggcggcacc
gccgcgccggaggtggccgacgaggccagcgccggcaacgccgaggcgctcgggatgccc
tacttcgtctcgaagctccggggtgagcgggccgcgcgggcgctcgccgcgcgcggcctg
gcgctggtggtggtccgcccggcgtacgtgctcgggccgggcgacgtccacggctcgtcg
gcgtcgatcctgctcgcgttcgcgcagcgccgcatccccgcgtacgtggagggcggcgcg
tccttctgcgacgtgcgcgacgtggcggaggggcacgtggccgccctggagcgcgggcgc
cccggcgaggcgtacgtgctcgccggccacaacctggccatgtcggagatgatccggcgc
gcctgcgccatcgccggcgtcccgcccccgccgcgcgtgccggtgccgctggcgctcggg
ttcgccgcggtgcaggagctggcggcgcgcgcggccggccggcggccgcggacgagccgc
ggcctggtccgcgccagcgcgctgtacacgttcgcgtcctcggcgaaggcggagcgcgag
ctcggctaccgcgtccgaccgttcgaggagatggtccgcgacacctaccgctgggccatc
gccaccggccgcctgcggccggacacgcccgagctgaaggcgctgaacgacggcccgtga

DBGET integrated database retrieval system