KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0981Help
Entry
A2cp1_0981        CDS       T00833                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00061  Fatty acid biosynthesis
acp00071  Fatty acid degradation
acp01100  Metabolic pathways
acp01212  Fatty acid metabolism
acp02024  Quorum sensing
Module
acp_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A2cp1_0981
   00071 Fatty acid degradation
    A2cp1_0981
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A2cp1_0981
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acp01004]
    A2cp1_0981
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acp04147]
    A2cp1_0981
Enzymes [BR:acp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     A2cp1_0981
Lipid biosynthesis proteins [BR:acp01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   A2cp1_0981
Exosome [BR:acp04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   A2cp1_0981
  Exosomal proteins of breast cancer cells
   A2cp1_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ACL64332
UniProt: B8JEK6
Position
1107464..1109284
Genome map
AA seq 606 aa AA seqDB search
MPDTQPRNVPELFLERVGLTPDAEAFRHPAGAGWRSLTWADTEARVRAISAGLRALGVQS
EQVCAILASTRIEWVLSDFGILCAGAATSTIYPSSTAEECAYILADSGAVVAFAEDGLQV
AKLASRRAEMPALRHVVVFDGEGSADGWVTPLADLEARGRAWDAEHPGAFEETAASVRPD
ALATLLYTSGTTGVPKGVELTHSCWVSQSASVQASGILDHEDPVQFFWLPLAHSFGKMIG
TAQLRIGFPTAVDGRVDRIVENLGVVRPTFVCAVPRIFEKVHNKILSNARDGGPVKAAIF
RWAIDVGLVASRARRAGRPPGTLLQAQLAVADRLVFHKVRELFGGRLRFFVSGSAPLSRD
IAEFFDAMGIVILEGYGLTESSAATHANLPSKRKIGTVGPAFRGIEVRIAEDGEILMRGP
WIMRGYRGMPEQTAEALDPEGWLHTGDVGFVDADGFLSITDRKKDLIKTSGGKYVAPAEL
ESKLKAISPFVSQVLVHGDRRNFVTALVTLDADAIAKWAAEHGHAGQPVSALARLPEVQE
LLQRHVDRLNAGLPRFATVKKFAILPRELSEAEGEVTPSQKLKRKVIEQHFRAEIDAMYG
GEPPRA
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgacacccagccccgcaacgtccccgagctcttcctcgagcgcgtcggcctcacg
ccggacgccgaggcgttccgccatccggccggtgcgggctggcgcagcctgacctgggcg
gacaccgaggcgcgggtgcgcgcgatctccgcgggcctccgggcgctcggcgtccagtcg
gagcaggtctgcgccatcctggcgtccacccggatcgagtgggtgctctccgacttcggc
atcctgtgcgccggcgccgccaccagcaccatctacccgtcctccaccgcggaggagtgc
gcgtacatcctggccgactcgggcgcggtggtggcgttcgcggaggacgggctgcaggtc
gcgaagctggcctcgcgccgcgccgagatgccggcgctccggcacgtggtggtgttcgac
ggcgagggcagcgcggacggctgggtgacgccgctcgccgacctggaggcgcgcggccgc
gcctgggacgcggagcaccccggcgcgttcgaggagacggccgcgtcggtgcgccccgac
gcgctcgccaccctgctctacacctccggcacgaccggggtgcccaagggcgtcgagctc
acgcattcgtgctgggtctcgcagtcggcctcggtgcaggcctcgggcatcctcgaccac
gaggacccggtgcagttcttctggctgccgctcgcgcactcgttcgggaagatgatcggc
accgcccagctccggatcggcttccccaccgcggtggacggccgggtcgaccggatcgtc
gagaacctcggcgtggtgcgcccgacgttcgtgtgcgcggtgccgcggatcttcgagaag
gtgcacaacaagatcctctcgaacgcgcgcgacggcggcccggtcaaggccgccatcttc
cggtgggccatcgacgtggggctggtggcgtcgcgcgcgcgccgggccggccgcccgccc
gggacgctgctccaggcgcagctcgcggtggccgaccggctggtgttccacaaggtgcgc
gagctgttcggcggccgcctgcgcttcttcgtgtccggctcggcgccgctctcccgcgac
atcgccgagttcttcgacgcgatgggcatcgtcatcctggagggctacgggctcaccgag
tcgtccgcggcgacgcacgcgaacctgccctcgaagcggaagatcggcacggtcggcccc
gcgttccggggcatcgaggtgcgcatcgccgaggacggcgagatcctgatgcgcggcccg
tggatcatgcgcggctaccgcggcatgcccgagcagaccgccgaggcgctcgacccggag
ggctggctgcacaccggcgacgtcgggttcgtggacgcggacgggttcctgtccatcacc
gaccggaagaaggacctcatcaagacctccggcggcaagtacgtcgcgccggccgagctc
gagtccaagctgaaggccatctcgccgttcgtctcgcaggtgctggtccacggcgaccgg
cgcaacttcgtcaccgcgctcgtgacgctcgacgccgacgccatcgcgaagtgggcggcg
gagcacggccacgcgggccagccggtgtcggcgctcgcgcgactcccggaggtgcaggag
ctgctgcagcgtcacgtggaccgcctcaacgccgggctgccgcgcttcgccaccgtgaag
aagttcgccatcctgccgcgcgagctctccgaggcggagggcgaggtcaccccgtcgcag
aagctgaagcggaaggtgatcgagcagcacttccgcgccgagatcgacgcgatgtacggc
ggggagccgccgcgggcctag

DBGET integrated database retrieval system