KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1135Help
Entry
A2cp1_1135        CDS       T00833                                 

Definition
(GenBank) Conjugal transfer protein TrbC
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC DUF4134
Motif
Other DBs
NCBI-ProteinID: ACL64480
UniProt: B8JFP2
Position
1268172..1268447
Genome map
AA seq 91 aa AA seqDB search
MAAVFKRFVFTVALASSATNTEAQGLSRARSTLQNFQSELMLFVPIVAVVSLIILAILWG
LRIIHFRTLAQWGGGVLIVGAASQLVNMLLS
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgttcaagcgattcgtgttcacggtggcactggcatcttcggcgacgaat
acggaggcgcaggggctctcgcgggcacgctcgaccctgcagaacttccagtccgagctc
atgctgttcgtgccgatcgtcgcggtcgtctcgctcatcatcctcgcgatcctctggggc
ctgcggatcatccacttccggacgctcgcgcagtggggcggcggcgtcctgattgtgggc
gccgcgagccagctcgtgaacatgctgctctcctga

DBGET integrated database retrieval system