KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1139Help
Entry
A2cp1_1139        CDS       T00833                                 

Definition
(GenBank) P-type DNA transfer protein VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A2cp1_1139
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acp02044]
    A2cp1_1139
Secretion system [BR:acp02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   A2cp1_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS
Motif
Other DBs
NCBI-ProteinID: ACL64484
UniProt: B8JFP6
Position
1272603..1273298
Genome map
AA seq 231 aa AA seqDB search
MKHLRTLVVAGGFAFATAAHAQGIPVFDSSSFGQMVLSVKALGDQLRQLQATYQAVSGTR
NLGEVLYNPALRGYLPADWARVYDTAAAGGYPGISGPLRAVQDGERLRGTVTDAQASIAA
RSRTTAMADKATGLHAFEGARARLSQIEQLMRQINLTHDAKGVQEIQARIAVEQAAVQNE
TTKLQLVAMLQRAEERLVEQQKTDLAQRILSASNRGMPPCCSVDPGAGARR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacctccgaacgttggtagtcgccggaggcttcgcgttcgcgaccgcggcgcac
gcgcagggcatcccggtgttcgactcgtcgagcttcggtcagatggttctgtcggtgaag
gcgcttggggatcagctcagacagctccaggccacgtaccaggccgtgagcggaacccgt
aacctcggtgaagtgctctacaacccggcgctccgaggttacctgccggcggactgggcg
cgcgtttacgacaccgcggccgcaggaggctaccccgggatctccgggccactccgggcc
gtccaggacggtgagcggcttcgcggcaccgtcaccgacgcgcaggcgagcatcgcggct
cggagccggacgacagcgatggccgacaaggctacgggcctgcatgcgttcgagggtgcg
cgggcgcgcctctcccagatcgagcagctcatgcggcagatcaacctcacgcacgatgcc
aagggcgtacaggagatccaggcgcgcatcgcggtggagcaggccgcggtgcagaacgag
acgacgaagctccagctcgtcgccatgctccagcgcgctgaggagcggctcgtcgagcag
cagaagaccgacctcgcgcaacggatcctctccgcatccaaccgcgggatgccgccgtgc
tgctcggtcgacccgggcgcgggcgcgcggaggtga

DBGET integrated database retrieval system