KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1587Help
Entry
A2cp1_1587        CDS       T00833                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00770  Pantothenate and CoA biosynthesis
acp01100  Metabolic pathways
Module
acp_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A2cp1_1587
Enzymes [BR:acp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     A2cp1_1587
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     A2cp1_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N CW_binding_2
Motif
Other DBs
NCBI-ProteinID: ACL64931
UniProt: B8J576
Position
1774483..1775700
Genome map
AA seq 405 aa AA seqDB search
MDFRNRTVVVCVGGGIAAYKACDLTRLIVKGNGKVRVAMTPAATRFVAPLTFQALSGAPV
LTDLFEPAADLTYGHLEMARVADLVVVAPATADLIARIRAGMADDAVTTAVLAATCPVLL
APAMNTRMWRNVATQENLAALRARGMHVVGPAAGLLADGDVGEGRLAEPQEIALAAARLL
GRQDLAGRKVLVTAGPTREPIDPVRFVSNPSSGKMGYAVARVAARRGAQVTLVSGPTALE
DPSGVEVVRVETAEEMARAVESAQAEMDLFVGAAAVSDYRPAAPAAHKLKKKPGEETLVL
ARTPDILAGLGARHAGRPGAPVLVGFAAETEEVIARAREKLKGKRCDLVVANKVGAPGAG
FGGDTNRVALVSAAELAEIEGTKDKVAEAILDWILPVLDARRPRG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacttccgcaaccggacggtggtggtgtgcgtgggcggcggcatcgccgcgtacaag
gcctgcgacctcacgcgactcatcgtgaaggggaacggcaaggtgcgcgtcgccatgacc
ccggccgcgacccgcttcgtcgccccgctcacgttccaggcgctgtccggcgcgcccgtg
ctcaccgacctgttcgagccggcggcggacctcacctacggccacctcgagatggcgcgc
gtcgccgacctggtggtggtcgcgcccgccaccgccgacctgatcgcgcggatccgcgcc
ggcatggcggacgacgccgtcaccaccgcggtgctcgccgccacctgcccggtgctgctc
gcccccgccatgaacacgcggatgtggcgcaacgtcgcgacgcaggagaacctggccgcg
ctgcgggcgcgcgggatgcacgtggtcggcccggccgcggggctgctcgccgacggggac
gtgggcgagggccggctcgccgagccgcaggagatcgcgctcgccgccgcgcggctgctg
ggacgccaggacctggccgggcgcaaggtgctggtgaccgccggcccgacccgcgagccc
atcgacccggtccgcttcgtctccaacccgtcgtcggggaagatgggctatgcggtggcg
cgggtggcggcccgccgtggcgcgcaggtgacgctcgtgtcggggcccaccgcgctggag
gacccctccggcgtcgaggtggtgcgcgtcgagaccgccgaggagatggcgcgcgcggtc
gagtcggcccaggcggagatggatctgttcgtgggcgcggccgccgtgtcggattaccgg
cccgccgcgccggccgcgcacaagctcaagaagaagccgggcgaggagacgctggtgctc
gcgcgcacgccggacatcctggccgggctgggcgcgcgccacgccggcaggcccggcgcg
ccggtgctggtggggttcgcggcggagaccgaggaggtcatcgcgcgcgcccgcgagaag
ctgaagggcaagcgctgcgacctggtggtggcgaacaaggtcggcgccccgggcgccggc
ttcggcggcgacaccaaccgcgtggcgctcgtctcggccgccgagctggccgagatcgag
gggacgaaggacaaggtcgccgaggcgatcctggactggatcctgcccgtgctcgacgcg
cgccgcccgcgaggctga

DBGET integrated database retrieval system