KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1726Help
Entry
A2cp1_1726        CDS       T00833                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00630  Glyoxylate and dicarboxylate metabolism
acp01100  Metabolic pathways
acp01110  Biosynthesis of secondary metabolites
acp01120  Microbial metabolism in diverse environments
acp01200  Carbon metabolism
Module
acp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A2cp1_1726
Enzymes [BR:acp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     A2cp1_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACL65068
UniProt: B8J5X1
Position
complement(1925132..1927378)
Genome map
AA seq 748 aa AA seqDB search
MDFEQEVAALRRWFESPRFAGIRRIHTAREVMEQRGTIRQDYPVAREAAEAFHARLRELF
QQRRCITTFGPYSPGQAVAMKKMGIEAIYLGGWATSAKGSVQEDPGPDLASYPLSQVPDE
AAPIVRALLTADRNQHHARSRMTEEQRRATPAVDFRPFIIADADTGHGGDAQVRNLVRRF
VEVGVPGYHIEDQKPGVKKCGHQGGKVLVAEDEQLKRLSAARFQLDLMGVPGIVVARTDA
ESATLLDGRGDERDQPFILGASNLAVPAFRAAFLAILRRFRRAGVEELSGHELYAVCDEE
YAAADAWLERTGFDKAIAAAAAEHQRGALAVDAALDRVFDRFVDAWQQEAGVCTYAEAVA
QAIAFREHEGEHPTMRRDEWMAFAARAPFYRAREKARAMGIDTPWDCEHAKTPDGYYQVR
GGIDYAIQKSLAAAPFADLLWMETKTADLADARRFADAIHAVHPDKMLAYNLSPSFNWDT
TGMDDEQMRRFPEELGKLGYVFDFITYGGHQIDGLAAEEFATALREDGMLALARLQRKFR
LLESGYRTPQTLVGGPRLDAALMAVSGRTATTKAMGQGSTQHQHLVQTEVPPRLLEDWLD
LWRERHGVQGKLRAALRPVTAGSDLLELVVTSADGERKLDVTFASITDRRGRSILSVRDQ
NTHDLALRRKRLMTLAQLFLFHRYRVDSAHYVTPTEDNQRQAEGMKALGLFRSVAQEVGA
IIVADVDRARVKALAARDHVALKALLGA
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgagcaggaggtcgcggccctgcgccgctggttcgagagcccacggttcgcg
ggcatccggcgcatccacaccgcccgcgaggtgatggagcagcgcggcacgatccgccag
gactacccggtggcgcgggaggccgccgaggcgttccacgcgcgcctgcgcgagctgttc
cagcagcggcgctgcatcaccacgttcggcccctactcgcccgggcaggccgtggccatg
aagaagatgggcatcgaggccatctacctgggcggctgggccacctcggccaagggctcg
gtgcaggaggaccccggccccgacctcgccagctacccgctcagccaggtgcccgacgag
gcggcgcccatcgtgcgcgcgctgctcacggcggaccggaaccagcaccacgcccgctcg
cgcatgaccgaggagcagcggcgcgccaccccggcggtggacttccggccgttcatcatc
gccgacgccgacaccggccacggcggcgacgcgcaggtgcgcaacctcgtccgccgcttc
gtcgaggtcggggtgcccggctaccacatcgaggaccagaagccgggcgtgaagaagtgc
gggcaccagggcggcaaggtgctggtcgccgaggacgagcagctgaagcgcctctccgcg
gcgcggttccagctcgacctcatgggcgtgcccgggatcgtggtggcgcgcaccgacgcg
gagtcggccacgctgctcgacggccgcggcgacgagcgcgaccagccgttcatcctgggc
gcgagcaacctcgcggtcccggcgttccgcgcggcgttcctggcgatcctgcgccggttc
cgccgcgccggcgtggaggagctctccggccacgagctgtacgcggtgtgcgacgaggag
tacgcggccgccgacgcctggctggagcggaccggcttcgacaaggccatcgccgccgcc
gccgccgagcaccagcgcggcgcgctcgcggtggacgccgcgctcgaccgggtgttcgac
cggttcgtggacgcgtggcagcaggaggccggcgtctgcacctacgccgaggcggtggcg
caggcgatcgcgttccgcgagcacgagggcgagcacccgaccatgcggcgggacgagtgg
atggcgttcgcagcgcgcgcgccgttctaccgggcgcgcgagaaggcgcgcgccatgggg
atcgacacgccctgggactgcgagcacgccaagacgccggacggctactaccaggtgcgc
ggcggcatcgactatgccatccagaagtcgctcgcggcggcgccgttcgccgacctgctc
tggatggagaccaagacggccgacctcgccgacgcgcggcgcttcgccgacgccatccac
gcggtccacccggacaagatgctcgcctacaacctgtccccgtcgttcaactgggacacg
accggcatggacgacgagcagatgcgccgcttccccgaggagctcggcaagctcgggtac
gtcttcgacttcatcacctacggcggccaccagatcgacgggctggcggcggaggagttc
gcgacggcgctgcgcgaggacggcatgctggcgctggcgcggctgcagcggaagttccgc
ctgctcgagtcgggctaccggacgccgcagacgctggtgggcggaccgcgcctcgacgcg
gcgctcatggccgtctccggccgcaccgccaccaccaaggccatgggccagggctcgacc
cagcaccagcacctggtccagaccgaggtgccgccgcggctgctggaggactggctcgac
ctttggcgcgagcggcacggcgtccagggcaagctgcgcgcggcgctccggccggtcacc
gcgggctccgacctgctcgagctggtggtcacctcggccgacggcgagcggaagctcgac
gtcaccttcgcgagcatcaccgaccggcgcgggcgcagcatcctgtcggtccgcgaccag
aacacgcacgacctggcgctgcggcgcaagcggctcatgacgctcgcgcagctgttcctg
ttccaccgctaccgggtggactcggcgcactacgtcacgcccaccgaggacaaccagcgg
caggcggagggcatgaaggcgctcgggctgttccgctcggtggcgcaggaggtcggtgcg
atcatcgtcgccgacgtggaccgggcgcgggtgaaggcgctcgccgcgcgggaccacgtg
gcgctgaaggcgctcctcggcgcctga

DBGET integrated database retrieval system