KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1787Help
Entry
A2cp1_1787        CDS       T00833                                 

Definition
(GenBank) Methyltransferase type 11
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Brite
KEGG Orthology (KO) [BR:acp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:acp03009]
    A2cp1_1787
Enzymes [BR:acp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     A2cp1_1787
Ribosome biogenesis [BR:acp03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A2cp1_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 Methyltransf_31 Methyltransf_17 Methyltransf_2 Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: ACL65129
UniProt: B8J6E8
Position
1997115..1997960
Genome map
AA seq 281 aa AA seqDB search
MLPEILRHLRCPVCRAPLTAVPGAVRCPAGHAFDLARQGYVNLLRGRSPGTGDDADMVAA
REAFLGAGHFAPLGAALARAAQAHAGPDGIVLEVGAGTGHHLRSVLEALPDRFGLALDLS
RHAARRAARAHPRLGAVVADAWEPLPIADACAALVLDVFAPRNVAEFRRVLAPGGALLLV
TPAPAHLAELRKPLGLLEVDPDKARRVSEALEGRFALAASESLEWTLSLPRTDVLAAARM
GPSAHHTALDVLAARVAGLDEPVRVSAAVQVQVYRPAASAA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgctccccgagatccttcgacatctgcgctgccccgtctgccgggcaccgctcaccgcg
gttcccggagccgtgcgctgtccggcggggcacgcgttcgatctcgcgcgccagggctac
gtgaacttgcttcgcggccgctcgccgggcaccggcgacgacgctgacatggtcgccgcc
cgcgaggcgttcctcggcgcgggacacttcgcgcccctgggggcggcgctcgcgcgcgcg
gcccaggcgcacgccggccccgacggcatcgtgctggaggtcggcgcggggacaggacac
catctccgctccgtgctcgaggcgcttccggatcgcttcggactcgccctggacctctcc
cgccacgccgcgaggcgggccgcgcgggcacacccgcgcctgggcgccgtggtcgccgac
gcctgggagccgctgccgatcgcggatgcgtgcgcggcgctggtcctcgacgtcttcgcg
cccaggaacgtcgcggagttccggcgcgttctcgcgccgggcggagcgctgctcctcgtc
acccccgcgcccgcgcacctcgccgaactgcgtaagccgctcgggctgctcgaggtcgac
cccgacaaggcgcgccgggtgtcggaggcgctggagggccgcttcgcactcgcggcctcg
gagtcgctcgagtggaccctctccctcccgcggaccgacgtcctcgccgcggctcggatg
ggcccgtccgcccaccacaccgccctcgacgtcctcgctgcgcgcgttgccgggctcgac
gaaccggtgcgtgtgtccgccgcggtccaggtgcaggtgtaccggccggcggcgagcgcg
gcgtga

DBGET integrated database retrieval system