KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2023Help
Entry
A2cp1_2023        CDS       T00833                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp03010  Ribosome
Brite
KEGG Orthology (KO) [BR:acp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A2cp1_2023
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:acp03011]
    A2cp1_2023
Ribosome [BR:acp03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A2cp1_2023
  Bacteria
    A2cp1_2023
  Archaea
    A2cp1_2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACL65364
UniProt: B8J865
Position
2275028..2275468
Genome map
AA seq 146 aa AA seqDB search
MAETQTTTPKKKAERRAPPPARARKNRPAAPAPGPHASLSYLRVAPRKVRIVADEVRGMK
VGDALAMLKYTPQSAAKPLAKLLRSAVANAEQGGGRVDVDALFVKTLTVDQGPKMRRFMA
RAMGRAFRVEKKTSHVYVELGTAARG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggccgagacccagaccacgacgccgaagaagaaggccgaacgccgcgctccgccgccg
gcgcgcgcccgcaagaaccgccccgccgccccggcgccggggccgcacgcctccctcagc
tacctgcgcgtcgcgccgcgcaaggtgcgcatcgtcgcggacgaggtccgcgggatgaag
gtcggcgacgcgctcgcgatgctgaagtacacgccgcagtccgccgccaagccgctcgcg
aagctgctgcggtcggcggtcgcgaacgccgagcagggcggcggccgcgtggacgtggac
gcgctgttcgtgaagacgctgaccgtggaccagggcccgaagatgcgccgcttcatggcg
cgcgcgatgggccgggcgttccgggtcgagaagaagaccagccacgtgtacgtggagctc
ggtaccgccgcgcgcggctag

DBGET integrated database retrieval system