KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2423Help
Entry
A2cp1_2423        CDS       T00833                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00010  Glycolysis / Gluconeogenesis
acp00051  Fructose and mannose metabolism
acp00562  Inositol phosphate metabolism
acp01100  Metabolic pathways
acp01110  Biosynthesis of secondary metabolites
acp01120  Microbial metabolism in diverse environments
acp01130  Biosynthesis of antibiotics
acp01200  Carbon metabolism
acp01230  Biosynthesis of amino acids
Module
acp_M00002  Glycolysis, core module involving three-carbon compounds
acp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A2cp1_2423
   00051 Fructose and mannose metabolism
    A2cp1_2423
   00562 Inositol phosphate metabolism
    A2cp1_2423
Enzymes [BR:acp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A2cp1_2423
Exosome [BR:acp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A2cp1_2423
  Exosomal proteins of bladder cancer cells
   A2cp1_2423
  Exosomal proteins of melanoma cells
   A2cp1_2423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM VBS
Motif
Other DBs
NCBI-ProteinID: ACL65761
UniProt: B8JBD4
Position
complement(2681347..2682108)
Genome map
AA seq 253 aa AA seqDB search
MARTKFVCGNWKMHKTVAEAVQLVKELAAGLGDAAGKVQVAVAPPFTALHAAAQAAAGSA
VEVAGQDVHWEVQGAFTGEVSAAMLAEAGCRHGIVGHSERRQLFGETDEAVRRKAGALLA
AGLAPIVCVGETLAEREAGRTLEVVDRQVRQGLAGLDAGALGRVTVAYEPVWAIGTGKTA
TAAQAQEVHAAIRKILRDLGGSVSDAIRIQYGGSVKPENAQELMSQPDVDGALVGGASLK
AKDFLAIVKGALR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcaccaagttcgtctgcggcaactggaagatgcacaagacggtcgccgaggcg
gtccagctcgtgaaggagctggccgccgggctcggcgacgccgccgggaaggtgcaggtg
gcggtggcgccgccgttcaccgccctccacgccgccgcgcaggccgcggccggctcggcc
gtcgaggtcgcggggcaggacgtgcactgggaggtccagggcgcgttcaccggcgaggtg
tccgccgcgatgctggcggaggcgggctgccgccacggcatcgtgggccacagcgagcgg
cgccagctgttcggcgagaccgacgaggccgtccgcaggaaggccggggcgctgctcgcc
gccgggctcgcgcccatcgtctgcgtcggcgagacgctcgccgagcgcgaggccggccgg
acgctcgaggtggtcgaccggcaggtgcggcaggggctcgccgggctggacgccggcgcg
ctgggccgggtgacggtcgcctacgagccggtgtgggccatcggcaccgggaagaccgcc
accgccgcccaggcgcaggaggtccacgccgccatccggaagatcctccgcgacctgggg
ggttccgtgtcggacgcgatccggattcaatacggcggctcggtgaagcccgagaacgct
caggagctcatgtcccagcccgacgtcgacggcgcgctcgtcggcggggccagcctcaag
gcgaaggatttcctcgccatcgtgaaaggtgcactccgttga

DBGET integrated database retrieval system