KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2459Help
Entry
A2cp1_2459        CDS       T00833                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00790  Folate biosynthesis
acp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A2cp1_2459
Enzymes [BR:acp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     A2cp1_2459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACL65797
UniProt: B8JBH0
Position
complement(2716177..2717028)
Genome map
AA seq 283 aa AA seqDB search
MRMRIGARLFDGPGPFVMGVVNATPDSFSDGGRFLERDAAVAHALRLADEGADLVDLGGE
STRPGAPPVTADEELRRVVPVVAALRARGFTLPISVDTWKARVAREALAAGADLVNDVTG
LADPDMGGVVAGAGVPIVLQHMRGTFADMATRAVYADVVEEVAAELDEALARAGAAGIPR
DRVVLDPGIGFAKDARQSLELLARVGELRRLGCPLLVGPSRKSFIGKVTGAPAAERLPGT
LAAVTACVLAGVELVRVHDVAAARQAADVAAAIRGAARAPGPL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggatgcggatcggggccaggctcttcgacgggcctggccccttcgtcatgggggtc
gtgaacgcgaccccggactcgttctcggacggcggccggttcctcgagcgcgacgcggcg
gtggcgcacgcgctgcggctcgcggacgagggcgccgatctggtggacctgggcggcgag
tccacccggcccggcgcgccgccggtgacggccgacgaggagctccggcgggtggtgccg
gtcgtcgccgcgctgcgcgcgcgcgggttcacgctcccgatctcggtggacacgtggaag
gcgcgggtggcgcgggaggcgctcgcggccggggcggacctggtgaacgacgtgaccggc
ctcgccgacccggacatgggcggcgtggtcgccggggccggcgtgccgatcgtgctccag
cacatgcgcggcacgttcgccgacatggccacgcgcgcggtgtatgcggacgtggtcgag
gaggtcgccgccgagctggacgaggcgctggcccgggccggggcggccggcatcccgcgc
gatcgcgtggtgctcgaccccggcatcggcttcgcgaaggacgcccggcagagcctggag
ctgctggcgcgggtcggggagctgcggcgcctcgggtgcccgctgctggtgggcccgtcg
cgcaagagcttcatcgggaaggtcaccggcgcgcccgcggcggagcgcctgcccggcacg
ctcgcggcggtgaccgcgtgcgtgctggccggcgtggagctggtgcgcgtccacgacgtc
gcggccgcccggcaggcagccgacgtcgcggccgcgatccggggagcggcgcgcgctccc
ggtccgctgtag

DBGET integrated database retrieval system