KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2642Help
Entry
A2cp1_2642        CDS       T00833                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00450  Selenocompound metabolism
acp00970  Aminoacyl-tRNA biosynthesis
acp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A2cp1_2642
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A2cp1_2642
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acp01007]
    A2cp1_2642
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acp03016]
    A2cp1_2642
Enzymes [BR:acp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A2cp1_2642
Amino acid related enzymes [BR:acp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A2cp1_2642
Transfer RNA biogenesis [BR:acp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A2cp1_2642
 Prokaryotic type
   Other AARSs
    A2cp1_2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Zn-ribbon_8 Ribosomal_L32p
Motif
Other DBs
NCBI-ProteinID: ACL65979
UniProt: B8JDD0
Position
complement(2914749..2916833)
Genome map
AA seq 694 aa AA seqDB search
MSQRLLVTSALPYANGPIHLGHLVEYVQTDVYVRFRRACGDDVAYVCAADSHGTPIEVNA
AKVGMTPKAFVEKYRAEQHADFHAFGVEFSTYYTTDSDENRRWAYRVYDALKAKGLIYKK
SVEQLYCEVDRRFLPDRFVKGTCPKCGTPDQYGDVCEHCGTTYDPRELKDPYCAICRSSP
VVRASDHAYVNLRKPDVNAVIHEWVNAEGHLEPAVREQVKGWLADLQDWCITRDAPYFGF
PVTDPEFPGKFLYVWVDAPIGYLSSAEHYFAAEAPDGERLAPAEFERRYLAVGAPARLEH
FIGKDILRFHAVFWPAMLWATGLKRPDRMPVHGHLTVNGEKMSKSRGTFVTGRTYLESGL
DPELLRYFYAANLGSGVSDLDLSLDEFRNRINADLANNVANLASRVAALLQRLPGGVTAP
LDPEIAAATREAVKGARAAYQVLETRDVVRLVSQAASVCNRRVQETKPWENPAGDAERSV
LYTTGKALLGLARVLAPILPRFSAALAAAYGRPELPAWTPDLEPFDGAPVQVVEKPPQIA
RVDAKQVQRLIVPAAEAAPAKVARAQSPAETATRASAKPAPPPVPGVIQYDDFAKVELRV
GLVKAAEKVEKADKLLKLSVDVGEPEPRTIVAGIAQAYPEPQALVGRRIVVVANLAPRPL
RGITSHGMLLAAGEPPNLQVVTVGEGIAPGTRVK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
ttgagccagcgtctcctcgtcacgagcgcgctgccgtacgcgaacggccccatccacctc
ggccacctggtcgagtacgtccagaccgacgtctacgtgcgcttccggcgcgcctgcgga
gacgacgtcgcctacgtgtgcgccgccgactcccacggcacgcccatcgaggtgaacgcc
gccaaggtcgggatgacgccgaaggcgttcgtggagaagtaccgcgccgagcagcacgcc
gacttccacgcgttcggggtggagttctcgacctactacaccaccgactccgacgagaac
cgccgctgggcctaccgcgtgtacgacgcgctcaaggcgaaggggctcatctacaagaag
tcggtcgagcagctctactgcgaggtcgatcggcgcttcctgcccgaccggttcgtgaag
ggcacctgcccgaagtgcgggacgcccgaccagtacggcgacgtctgcgagcactgcggg
accacctacgatccccgcgagctgaaggacccgtactgcgccatctgccgctcgtcgccg
gtggtgcgcgccagcgaccacgcgtacgtcaacctccgcaagcccgacgtgaacgcggtc
atccacgagtgggtgaacgcggaggggcacctcgagccggcggtgcgcgagcaggtgaag
ggctggctcgccgacctgcaggactggtgcatcacccgcgacgcgccgtacttcggcttc
ccggtgaccgaccccgagttcccgggcaagttcctctacgtgtgggtggacgcgcccatc
ggctacctgtcctccgccgagcactacttcgcggccgaggcgccggacggcgagcggctg
gcgccggccgagttcgagcggcgctacctcgcggtgggcgcgccggcccggctcgagcac
ttcatcggcaaggacatcctgcgcttccacgcggtgttctggccggcgatgctctgggcc
accggcctgaagcgcccggaccggatgccggtccacgggcacctcaccgtcaacggcgag
aagatgtcgaagtcccgcggcaccttcgtcaccggccggacctacctcgagtccgggctc
gacccggagctgctgcgctacttctacgcggcgaacctgggcagcggcgtctccgacctc
gacctgtcgctggacgagttccgcaaccgcatcaacgccgacctcgcgaacaacgtcgcg
aacctggcctcgcgcgtggccgcgctgctgcagcggctgcccggcggcgtcaccgcgccg
ctcgaccccgagatcgccgccgcgacgcgcgaggcggtgaagggcgcccgcgccgcgtac
caggtgctcgagacccgcgacgtggtccgcctggtgagccaggccgccagcgtctgcaac
cgccgcgtgcaggagacgaagccctgggagaacccggccggcgacgcggagcggagcgtg
ctctacaccaccggcaaggcgctcctcggcctcgcccgcgtgctcgcgcccatcctgccg
cgcttctcggcggcgctcgccgcggcctacgggcggcccgagctgccggcctggacgccg
gacctcgagccgttcgacggcgcgccggtgcaggtggtcgagaagccgccgcagatcgcg
cgggtggacgcgaagcaggtgcagaggctgatcgtgccggccgccgaggcggcgccggcg
aaggtcgcgcgcgcccagagccccgccgagacggccacccgcgccagcgccaagccggcg
cccccgccggtccccggggtcatccagtacgacgacttcgcgaaggtggagctgcgggtc
gggctggtgaaggccgccgagaaggtggagaaggccgacaagctgctgaagctctcggtg
gacgtgggcgagccggagccgcgcacgatcgtggccggcatcgcgcaggcctacccggag
ccgcaggcgctggtgggccggcgcatcgtggtggtcgcgaacctcgcgccccgtccgctg
cgcgggatcacctcccacgggatgctgctcgccgccggcgagccgccgaacctccaggtg
gtgaccgtgggcgagggcatcgcgcccgggacacgggtcaagtag

DBGET integrated database retrieval system