KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2668Help
Entry
A2cp1_2668        CDS       T00833                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00020  Citrate cycle (TCA cycle)
acp00620  Pyruvate metabolism
acp00650  Butanoate metabolism
acp01100  Metabolic pathways
acp01110  Biosynthesis of secondary metabolites
acp01120  Microbial metabolism in diverse environments
acp01130  Biosynthesis of antibiotics
acp01200  Carbon metabolism
Module
acp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A2cp1_2668
   00620 Pyruvate metabolism
    A2cp1_2668
   00650 Butanoate metabolism
    A2cp1_2668
Enzymes [BR:acp01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     A2cp1_2668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: ACL66005
UniProt: B8JDF6
Position
2944471..2946003
Genome map
AA seq 510 aa AA seqDB search
MSDRILHKGLKAKVMSAEEAAGLIPNGAILGMSGFTGAGYPKAVPIALSKRAIEERMKGK
PFKITALTGASTGPELDQAMGLTESVSFRFPYNGDAVMRQKINEGVIEYQDMHLSHAGSL
VRYGYYGRPDNKIDFAVIEVTKIKEDGSLVFSSSCGANTAYFDVAEKYILEVNEWQDERM
EGMHDILGVTGRHGERTPIPILRADDRVGSPTLKIDVSKVAAVVVTNNPDRNAPFKAPEA
DHKRIAQHILDFLDGEVKAGRLPKSLTPLQSGVGNIANAVLVGLNEGHFENMMSYTEVIQ
DGMLDLLDSGKLKIASATAFSVSPEGQERFNKNIDRYRKQIILRPQDVSNHPEVIRRLGC
IAMNGFVEADIYGHVNSTHIVGKGIENGIGGSGDFARNSAYTIFMSPSVAKGGKISAIVP
FASHIDHTEHEVNGIVTEYGFADLRGKSPKQKAKEVIEKCAHPDWRPILWDYYNRSLKGG
SFGKHTPHMLKEAFSFHTRYLETGDMRPKK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatcggattctccacaagggcctcaaggcgaaggtgatgtccgccgaagaagcc
gccgggctcatccccaacggcgccatcctcggcatgtcgggcttcaccggcgccggctat
cccaaggccgtccccatcgcgctctccaagcgcgcgatcgaggagcggatgaagggcaag
cccttcaagatcaccgccctcaccggcgcgtcgacgggccccgagctcgaccaggccatg
ggcctgacggagtcggtcagcttccgcttcccgtacaacggcgacgcggtcatgcggcag
aagatcaacgagggcgtgatcgagtaccaggacatgcacctgagccacgccggctcgctg
gtgcgctacgggtactacgggcgccccgacaacaagatcgacttcgccgtcatcgaggtc
acgaagatcaaggaggacggctcgctcgtcttctcgtcctcgtgcggcgcgaacaccgcg
tacttcgacgtcgcggagaagtacatcctcgaggtcaacgagtggcaggacgagcggatg
gaggggatgcacgacatcctcggcgtgaccggccgtcacggtgagcggacgccgatcccg
atcctccgcgccgacgaccgcgtcgggtcgcccacgctgaagatcgacgtgtcgaaggtc
gcggcggtggtggtcacgaacaaccccgaccgcaacgcgccgttcaaggcccccgaggcc
gatcacaagcggatcgcccagcacatcctcgacttcctcgacggcgaggtgaaggccggc
cggctcccgaagagcctcaccccgctgcagtcgggcgtcgggaacatcgcgaacgcggtg
ctcgtcggcctgaacgaggggcacttcgagaacatgatgagctacaccgaggtgatccag
gacggcatgctggacctcctcgactccggcaagctcaagatcgcgtccgcgacggcgttc
tcggtctcgcccgagggccaggagcggttcaacaagaacatcgaccgctaccgcaagcag
atcatcctgcgcccgcaggacgtgtcgaaccaccccgaggtcatccggcgcctcggctgc
atcgcgatgaacgggttcgtcgaggccgacatctacggccacgtgaactcgacccacatc
gtgggcaagggcatcgagaacggcatcggcgggtcgggcgacttcgcccgcaactcggcg
tacacgatcttcatgtccccgtcggtcgcgaagggcgggaagatctcggccatcgtcccg
ttcgcgtcgcacatcgaccacacggagcacgaggtcaacggcatcgtgaccgagtacggc
ttcgccgacctgcgcgggaagagcccgaagcagaaggcgaaggaagtcatcgagaagtgc
gcgcacccggactggcgcccgatcctctgggactactacaaccgctcgctgaagggcggc
agcttcgggaagcacacgccgcacatgctcaaggaggcgttctcgttccacacgcgctac
ctcgagacgggcgacatgcgcccgaagaagtag

DBGET integrated database retrieval system