KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2691Help
Entry
A2cp1_2691        CDS       T00833                                 

Definition
(GenBank) Adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00230  Purine metabolism
acp00250  Alanine, aspartate and glutamate metabolism
acp01100  Metabolic pathways
Module
acp_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A2cp1_2691
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A2cp1_2691
Enzymes [BR:acp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     A2cp1_2691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ACL66028
UniProt: B8JDH9
Position
complement(2969325..2970623)
Genome map
AA seq 432 aa AA seqDB search
MPNVVVVGAQWGDEGKGKIVDLLTQYADVVVRFQGGNNAGHTLVVGGEKTVLHLIPSGIL
HPGKSCVIGNGVVIDPEVLVLEIDRLKAKGALKDDGQLVVSLDAHVIMPWHKAIDVAREQ
AMGEGKIGTTGRGIGPTYEDKVARRGLRIRDLLDEARLARKVKERAALAREELARLGAKL
ELDEPALVKRYAELGRRVAGYATDVSIWLHRALQQGKSLLFEGAQGTMLDVDHGTYPFVT
SSNTVAGNAVVGCGLGPTAVDYVLGISKAYSTRVGGGPYPTELKDETGERLRKLGGEYGA
TTGRPRRTGWLDALALRYAVRVNGLSGIAMTKLDVLTGFDTVKIAVGYRLDGKVLDEMPS
DPEVIERCTPVYEELPGWTEKLEHLRTWDDLPPRARAYVKRVEELAGVKVVGCSVGADRG
ETILVENPFLAR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgtggtcgtcgtcggagcccagtggggcgacgagggcaagggcaagatcgtc
gatctgctgacccagtacgccgacgtggtggtgcggttccagggcggcaacaacgccggc
cacacgctggtggtcgggggcgagaagaccgtcctccacctcatcccgtccggcatcctc
cacccggggaagtcgtgcgtcatcgggaacggcgtggtgatcgaccccgaggtgctggtc
ctcgagatcgaccggctgaaggcgaagggcgcgctgaaggacgacggccagctcgtggtc
tcgctggacgcccacgtgatcatgccgtggcacaaggccatcgacgtggcgcgcgagcag
gccatgggcgagggcaagatcggcaccaccggccgcggcatcgggccgacctacgaggac
aaggtggcgcggcgcgggctgcgcatccgcgacctgctcgacgaggcgcgcctcgcccgc
aaggtgaaggagcgcgccgcgctcgcccgcgaggagctggcgcgcctcggcgcgaagctc
gagctcgacgagccggcgctggtgaagcgctacgccgagctgggccgccgcgtcgccggc
tacgccaccgacgtgtcgatctggctgcaccgcgcgctgcagcagggcaagtcgctcctg
ttcgagggcgcgcagggcaccatgctcgacgtggaccacggcacgtacccgttcgtcacc
agctcgaacacggtggccgggaacgcggtggtcgggtgcggcctcgggccgaccgcggtg
gactacgtgctcggcatctccaaggcctactccacgcgcgtgggcggcggcccgtacccc
accgagctgaaggacgagaccggcgagcggctgcgcaagctcggcggcgagtacggcgcc
accaccggccgcccgcgccgcaccggctggctggacgcgctcgcgctccgctacgcggtg
cgggtgaacgggctctccggcatcgccatgacgaagctcgacgtcctcaccggcttcgac
acggtgaagatcgcggtcgggtaccggctcgacggcaaggtcctcgacgagatgccgagc
gacccggaggtcatcgagcgctgcacgccggtgtacgaggagctgcccggctggaccgag
aagctcgagcacctgcgcacctgggacgacctgccgccgcgcgcccgcgcctacgtgaag
cgggtcgaggagctcgccggcgtgaaggtcgtcggctgctccgtcggcgccgaccgcggc
gagaccatcctggtcgagaacccgttcctggcgcgctga

DBGET integrated database retrieval system