KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2694Help
Entry
A2cp1_2694        CDS       T00833                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K16843  (S)-sulfolactate dehydrogenase [EC:1.1.1.310]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00270  Cysteine and methionine metabolism
acp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A2cp1_2694
Enzymes [BR:acp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.310  (S)-sulfolactate dehydrogenase
     A2cp1_2694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 IlvN AdoHcyase_NAD F420_oxidored NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACL66031
UniProt: B8JDI2
Position
complement(2972699..2974285)
Genome map
AA seq 528 aa AA seqDB search
MAARVLVSDDLSPEAVAVLKQAGLEVDVKVGLKPDALEAIIGDYDALAVRSATKVTAKLL
EKASRLRVIGRAGVGVDNVDLDAATRRGVVVMNTPGGSSVTVAELALAMILALSRHVPAA
TASVKAGKWEKKRFQGHELAGKTLGVVGIGNIGSVLVDRALAMKMRVVAYDPFISAEAAA
KLGVERVELDALWAQADVVSLHVPLTEQTRNLVDAKVLARMKKGALLVNCARGGIVDERA
LADALASGHLGGAALDVFEQEPPPADHPLLGLDGFVATPHIGASTEEAQSAVAVAVAEQL
AAYLNHGVVKNAVNVPGLPREIMDQIAPFLPLCEKLGSLAAQLAPQGPSEVTVEVAGELA
AAPIRPLAARTLAAFLRHHLETPVNDVSAPAVAKERGIAVREVRSAEPHDYASLVTVTVR
GQGGEAHVAGTVYGKREARLVRVDGFRLEAVPEGHVILCENDDAPGVVGNLGTALGAAGV
NIARISLSRLDDHSRAFAFLNVDSAPAPGVLEQVRRLPHVRTVRSIHL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccgtgtcctcgtgtccgatgacctttccccggaggccgtggccgtgttgaag
caggccggcctcgaggtggacgtgaaggtcggcctcaagcccgacgcgctcgaggccatc
atcggcgactacgacgcgctcgcggtgcgcagcgccaccaaggtgaccgcgaagctgctg
gagaaggcctcgcggctccgcgtgatcggccgcgccggggtcggcgtggacaacgtcgac
ctcgatgccgcgacccgccgcggcgtggtggtgatgaacacgccgggcggctcgtcggtc
acggtcgccgagctcgcgctcgcgatgatcctggcgctctcccgccacgtgccggccgcc
accgccagcgtgaaggcgggcaagtgggagaagaagcgcttccaggggcacgagctcgcc
ggcaagacgctgggcgtggtcggcatcggcaacatcgggtcggtgctggtggaccgcgcg
ctcgccatgaagatgcgcgtggtcgcctacgacccgttcatctccgccgaggccgcggcc
aagctgggggtcgagcgcgtcgagctggacgcgctctgggcccaggccgacgtcgtctcg
ctgcacgtcccgctcaccgagcagacccgcaacctggtggacgcgaaggtgctcgcccgc
atgaagaagggcgcgctcctggtgaactgcgcccgcggggggatcgtggacgagcgggcg
ctcgcggacgcgctcgcgtccgggcacctgggcggcgccgcgctggacgtgttcgagcag
gagccgcccccggccgatcacccgctgctcgggctggacgggttcgtcgccacgccgcac
atcggcgcctccaccgaggaggcgcagtcggcggtggcggtcgcggtggcggagcagctc
gccgcgtacctgaaccacggcgtggtgaagaacgcggtgaacgtgccggggctgccgcgg
gagatcatggaccagatcgcgccgttcctgccgctctgcgagaagctcgggtcgctcgcg
gcgcagctcgcgccgcaggggccgagcgaggtcaccgtcgaggtggccggagagctggcc
gccgcgccgatccgcccgctcgccgcgcgcacgctggcggcctttctgcgccaccacctc
gagacgccggtgaacgacgtgagcgccccggcggtcgcgaaggagcgcgggatcgcggtg
cgcgaggtccgctccgccgagccgcacgactacgccagcctggtcacggtgaccgtgcgc
gggcagggcggggaggcgcacgtcgcgggcaccgtgtacggcaagcgcgaggcccgcctc
gtgcgcgtggacgggttccgcctggaggcggtgccggagggccacgtcatcctgtgcgag
aacgacgacgcgcccggcgtggtcggcaacctcggcacggcgctcggcgcggccggcgtg
aacatcgcgcgcatctcgctgtcgcggctcgacgaccactctcgcgcgttcgccttcctg
aacgtggactcggcgcccgcgcccggggtcctcgagcaggtgcgcaggcttccgcacgtc
cggacggtccgctccatccacctgtga

DBGET integrated database retrieval system