KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_3955Help
Entry
A2cp1_3955        CDS       T00833                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00625  Chloroalkane and chloroalkene degradation
acp01100  Metabolic pathways
acp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A2cp1_3955
   00361 Chlorocyclohexane and chlorobenzene degradation
    A2cp1_3955
Enzymes [BR:acp01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     A2cp1_3955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 HAD Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ACL67278
UniProt: B8J8J2
Position
4408788..4409468
Genome map
AA seq 226 aa AA seqDB search
MALAPVRAAVFDAYGTLFDVASAAAEARGALGDRWQPLAELWRSKQLQYTWLRSLAGRHA
DFWQVTGDAVDFALEALGLADAALRARLMESYRHLAAYPEAKDVLTRLRGAGVRLAVLSN
GAPAMLASAAESAGLAGLLEQVLSVEDVGVYKPHPAVYRLAVDRLGVPAAEIVFVSSNGW
DAFGAKAFGYQVAWCNRAGQPAERLPAAPDAEIRSLAELPPLLGLP
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgccccggtccgcgccgccgtcttcgacgcttacggaaccctgttcgacgtg
gccagcgccgccgccgaggcgcgcggcgcgctcggcgaccgctggcagccgctcgccgag
ctgtggcgatcgaagcagctccagtacacctggctccgcagcctggccggccgccacgcc
gacttctggcaggtgaccggcgacgcggtcgacttcgcgctcgaggcgctcggcctcgcc
gacgcggcgctgcgcgcgcggctgatggagtcctaccgccacctcgccgcgtaccccgag
gcgaaggacgtcctcacgcgcctgcgcggcgccggcgtgcgcctggcggtgctctcgaac
ggtgcgccggccatgctcgcgtccgcggcggagagcgccgggctcgccggcctgctcgag
caggtcctctcggtggaggacgtgggcgtgtacaagccgcacccggccgtctaccggctg
gccgtggaccgcctcggcgtgcctgcggcggagatcgtgttcgtctcctcgaacggctgg
gacgcgttcggcgcgaaggcgttcggctaccaggtggcctggtgcaaccgcgccggccag
cccgcggagcggctccccgccgcccccgacgccgagatccgctcgctcgccgagctgccg
ccgctgctgggcctgccgtag

DBGET integrated database retrieval system