KEGG   Actinomyces sp. oral taxon 414: AM609_12235Help
Entry
AM609_12235       CDS       T04083                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
acq  Actinomyces sp. oral taxon 414
Pathway
acq00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AM609_12235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acq01007]
    AM609_12235
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acq03016]
    AM609_12235
Enzymes [BR:acq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     AM609_12235
Amino acid related enzymes [BR:acq01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   AM609_12235
Transfer RNA biogenesis [BR:acq03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AM609_12235
 Prokaryotic Type
    AM609_12235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1f tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1d
Motif
Other DBs
NCBI-ProteinID: ALD00031
UniProt: A0A0M4GSM8
Position
complement(3043983..3045545)
Genome map
AA seq 520 aa AA seqDB search
MSTQTTAAPALRLYDSAARAVVPLAPTVTPGTVAIYLCGATVQGSPHIGHMRSAIVFDVL
RRWLERCGQRVRLIRNVTDIDDKILAKSAAADPPEPWWAWAQRHEREFDAAYRALGVTAP
TYEPRATGHIPEMLDLVGRLLDAGHAYRGESGNVYFDVASLADYGSLTHQRLEDLATTED
ETQIDQAVEADKRDPRDFALWKAAKPAEPADAAWDAPWGRGRPGWHLECSAMSRRYLGET
FDIHGGGIDLRFPHHENEQAQSHGAGWGFARHWVHNAWVTVKGEKMSKSLGNSLTVAELL
RVYDPAVLRLALGTVHYRSTVEFSEETLADAAALWERLSGAVVRAREAVDGAGGADGADG
AGPDGAGPGAAGAVDAPAEAVRARALPAEYVAAMNDDLGLAGAMAVVHATLKRLNTELAA
PTPDAGAVAGAALDLRAQLDVLGLDPLARPWRARVLGVGPDGSAAAATAALDRLVSDLLD
ERAAARAARDWARADALRERLAAAGVVVEDGASGARWHLA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacccagaccaccgccgcgcccgccctgcgcctgtacgactccgccgcccgcgcc
gtcgtccccctggcgcccaccgtcacccccgggacggttgcgatctacctgtgtggcgcc
accgtccagggctcgccccatatcggccacatgcgctcggccatcgtcttcgacgtcctg
cgccgctggctcgagaggtgcggccagcgggtccgcctcatccgcaacgtcaccgacatc
gacgacaagatcctcgccaagtccgccgccgccgacccccccgagccctggtgggcctgg
gcccagcgccacgagcgcgaattcgacgccgcctaccgggccctgggcgtgaccgccccc
acctacgagccgcgggccaccgggcacatccccgagatgctcgacctcgtcgggcgactg
ctcgacgccggccacgcctaccgcggcgagtccggcaacgtctacttcgacgtggcctcc
ctggcggattacgggtcgctgacccaccagcggctggaggacctggccaccaccgaggac
gagacccagatcgaccaggccgtcgaggccgacaagcgcgacccgcgcgacttcgccctg
tggaaggccgccaagcccgccgaaccggccgacgccgcctgggacgccccctgggggcgc
gggcggcccggctggcacctggagtgctcggccatgtcccggcgctacctgggcgagacc
ttcgacatccacggcggaggcatcgacctgcgcttcccccaccacgagaacgagcaggcc
cagtcccacggcgccggctggggcttcgcccgccactgggtccacaacgcctgggtcacc
gtcaaaggcgagaagatgagcaagtccctgggcaactcgctgaccgtcgccgagctgctg
agggtctacgaccccgccgtcctgcgcctggcgctgggcaccgtccactaccgctccacc
gtggaattctccgaggagaccctggccgacgccgccgccctgtgggagcgtctgagcggt
gcggtcgtccgcgcccgggaggcggtcgacggcgctggtggggctgacggggctgacggg
gccggccccgacggcgctgggcccggcgccgccggggcggtggacgcccccgccgaggcg
gtccgcgcccgcgccctgccggccgaatacgtcgccgccatgaacgacgacctgggcctg
gccggcgccatggcggtggtccacgccaccctcaaacggctcaacaccgagctcgccgcc
ccgacccccgacgccggcgccgtcgccggggccgccctggacctgcgcgcccagctcgac
gtcctgggcctggaccccctcgcccggccctggcgcgcccgggtcctgggcgtcggaccg
gacgggagtgccgccgccgccaccgccgccctggaccgcctcgtgagcgacctgctcgac
gagcgcgccgccgcccgcgccgccagggactgggcgcgcgccgacgccctgcgcgagcgg
ctcgcggcggccggagtcgtcgtcgaggacggcgcctcaggggcgcgctggcacctggcc
tga

DBGET integrated database retrieval system