KEGG   Acidiphilium cryptum: Acry_0835Help
Entry
Acry_0835         CDS       T00527                                 

Definition
(GenBank) protein of unknown function DUF1491
Organism
acr  Acidiphilium cryptum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1491 YLP
Motif
Other DBs
NCBI-ProteinID: ABQ30054
UniProt: A5FWS2
Position
923192..923527
Genome map
AA seq 111 aa AA seqDB search
MSEPRVKAGIWVQMALRLGAADGRPGMLLHRGDEDAGGVLVLLRGRMGVVILSQTRDALG
RPAWLRATGPDPVDDARADAYVEKQLRFDPDLWVVEFEAPDYLPPFEGTIL
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaccccgcgtcaaggccggcatctgggtgcagatggcgctgcggctcggcgcc
gccgatggccggcccggcatgctgctgcaccggggcgacgaggatgccggcggcgtgctg
gtgctgctgcgcggccggatgggggtggtgatattgagccagacgcgcgatgccctcggc
cgccccgcctggctgcgcgccaccggccccgacccggtcgacgatgcgcgggccgatgcc
tatgtcgagaagcaactccgcttcgaccccgatctctgggtcgtcgagttcgaggcgccc
gattacctgccgcctttcgagggcacgatcctctga

DBGET integrated database retrieval system