KEGG   Acidiphilium cryptum: Acry_1086Help
Entry
Acry_1086         CDS       T00527                                 

Definition
(GenBank) Alpha/beta hydrolase fold-3 domain protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
acr  Acidiphilium cryptum
Pathway
acr00903  Limonene and pinene degradation
acr00930  Caprolactam degradation
acr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Acry_1086
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Acry_1086
Enzymes [BR:acr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     Acry_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 COesterase
Motif
Other DBs
NCBI-ProteinID: ABQ30301
UniProt: A5FXG9
Position
complement(1210422..1211339)
Genome map
AA seq 305 aa AA seqDB search
MPSLASHIVNPLIRAVVKSQLSADVSGRTEAAIARRVRRALGTPVLPPPGGRYVKGECGG
IPGLWTEPKAPPAATVLYIHGGGFIACSPATHKPFTLAFAKRGFRVFAPDYRLAPEHRFP
AALDDALAAYRGLLDAGGDPASLVIAGDSAGGGLALSTLVAAKRDGLPMPACAVLFSPWT
DLACAGDSMRTNLRADPMLCATTMPAAAALYLGAADERDPLASPLHADLAGLPPLCIHAS
AIEVLRDDSTRLATRAREAGVEVSIRLWDNMPHVWPIFQLLLPEARRTMDEVAEYLTARI
AQTRR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcctcgcctcccacatcgtcaacccgctcatccgcgcggtcgtcaagtcgcag
ctctccgccgacgtctccggccgcaccgaggcggccatcgcccgccgcgtccgccgcgcc
ctcggcaccccggtcctgccgccgcccggcggtcgctacgtgaagggcgagtgcggcggc
atccccggattgtggaccgagccgaaggcgccgcccgccgccaccgtgctctacatccat
ggcggcggcttcatcgcctgctcgccggccacgcacaaacccttcaccctcgccttcgcg
aagcgcggcttccgcgtcttcgcgccggactaccgcctcgcgccggaacaccgctttccc
gcggcgctcgacgatgcgctcgccgcctatcgcggcctgctcgatgcggggggcgatccg
gcctcgctcgtcatcgccggcgattccgcgggcggcggcctcgccctgtccaccctggtc
gcggcgaagcgcgacggcctgccgatgcccgcctgcgccgtgctgttctcgccctggacc
gatcttgcctgcgccggcgacagcatgcggaccaacctgcgcgccgacccgatgctctgc
gccaccaccatgcccgccgccgccgcgctctatctcggcgccgccgacgagcgcgatccg
ctcgcctcgccgctgcacgccgacctcgccggcctgccgccgctctgcatccacgccagc
gcgatcgaggtgctgcgcgacgacagcacccgcctcgccaccagggcgcgcgaggccggc
gtcgaggtcagcatccggctgtgggacaacatgccccatgtctggccgatctttcagctc
ctgctgcccgaggcgcggcggacgatggacgaggtcgccgaatacctcaccgcccgcatc
gcccaaacgcgccgttag

DBGET integrated database retrieval system