KEGG   Acidiphilium cryptum: Acry_1531Help
Entry
Acry_1531         CDS       T00527                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
acr  Acidiphilium cryptum
Pathway
acr00300  Lysine biosynthesis
acr01100  Metabolic pathways
acr01120  Microbial metabolism in diverse environments
acr01230  Biosynthesis of amino acids
Module
acr_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Acry_1531
Enzymes [BR:acr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Acry_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABQ30739
UniProt: A5FYQ7
Position
1693567..1694682
Genome map
AA seq 371 aa AA seqDB search
MTEADPVPLARDLLRSRSVTPEDDGAQTVLARALDALGFSIEWLRFGEVSNLVARRGSGS
PHFGFAGHTDVVPPGEGWRHDPFAAVIEDGLLFGRGAVDMKGAIAAFVAALAARPANHAG
TISLLITGDEEGDAVDGTRRILDHLAASGALPEFCLVGEPTCRARLGDTIKIGRRGSISA
HVTVRGVQGHVAYPHLADNPLHRLIPALEALRATTLDEGTAWFEPSSLQITSVDTGNKAG
NVIPASASARLNIRFNDRHTGPDLAAWIRDTVARHAPGAACDIGISGEAFLTEPGPVTTL
FSEAVAAVTGITPKLDTGGGTSDARFIAAHCPVAEFGLVGTSMHRVDEAVPVSELRALAE
IYGRILDRVFR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaggccgatcccgttcccctcgcgcgggacctgctgcgcagccgctcggtcacc
cccgaggacgatggcgcccagaccgttctcgcgagggcgctggacgccctgggtttctcg
atcgaatggctgcgcttcggcgaggtgagcaacctcgtcgcacgccgcggctcaggcagc
ccgcatttcggctttgccggccataccgacgtcgtgccgccgggcgaggggtggcgccac
gaccccttcgcggccgtcatcgaggacggcctgctgttcggacgcggcgcggtcgacatg
aagggcgccatcgccgccttcgtcgccgccctcgccgcccgcccggcaaatcatgcaggc
acgatctcgctcctcatcaccggcgatgaggaaggcgatgccgtggacggcacccggcgc
attctcgaccatctcgccgcctccggtgccctgccggaattctgcctggtcggcgagccg
acctgccgcgcccggctcggcgacacgatcaagatcggccggcgcggctcgatttcggcg
catgtgacggttcgcggcgtgcaaggccatgtcgcctacccccatctggccgacaacccg
ctccatcgcctgattccggcactcgaagccctgcgcgccacgacgcttgacgagggaacc
gcgtggttcgagccctcatcgctgcagatcaccagcgtcgataccggaaacaaggccggc
aacgtgatcccggcgagcgcctcggcccggctgaacatccgtttcaacgaccgccacacc
ggccccgatctcgccgcctggatccgcgataccgtggcccgccacgcccccggcgccgcc
tgcgacatcggcatcagcggcgaggccttcctgaccgaacccggccccgtgaccacgctg
ttcagcgaggcggtggcggcggtgaccggcatcacgccgaagctcgacaccggcggcggc
acgtcggatgcccgcttcatcgccgcgcactgccccgtcgccgaattcggcctggtcggc
acctcgatgcaccgggtggacgaggccgtgccggtgagcgagctgcgcgcgctggccgaa
atctacggccggatcctggaccgcgtgttccgatga

DBGET integrated database retrieval system