KEGG   Acidiphilium cryptum: Acry_1646Help
Entry
Acry_1646         CDS       T00527                                 

Definition
(GenBank) chaperone protein DnaK
  KO
K04043  molecular chaperone DnaK
Organism
acr  Acidiphilium cryptum
Pathway
acr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:acr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Acry_1646
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:acr03019]
    Acry_1646
   03110 Chaperones and folding catalysts [BR:acr03110]
    Acry_1646
   03029 Mitochondrial biogenesis [BR:acr03029]
    Acry_1646
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acr04147]
    Acry_1646
Messenger RNA biogenesis [BR:acr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     Acry_1646
Chaperones and folding catalysts [BR:acr03110]
 Heat shock proteins
  HSP70 / DNAK
   Acry_1646
Mitochondrial biogenesis [BR:acr03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    Acry_1646
  Matrix
   MMC/PAM proteins
    Acry_1646
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Acry_1646
Exosome [BR:acr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Acry_1646
  Exosomal proteins of breast cancer cells
   Acry_1646
  Exosomal proteins of colorectal cancer cells
   Acry_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF3153
Motif
Other DBs
NCBI-ProteinID: ABQ30851
UniProt: A5FZ19
Position
complement(1818260..1820167)
Genome map
AA seq 635 aa AA seqDB search
MSKVIGIDLGTTNSCVAIMEGKDVRVIENSEGARTTPSMVAFSESNERLVGQSAKRQAVT
NPTNTLYAVKRLIGRRYDDPTVEKDKGLVSYNIVRGDNGDAWVESRGQRYAPSQISSFVL
TKMKETAEAYLGEAVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYG
MDKKQGGTIAVYDLGGGTFDISILELGDGVFEVKSTNGDTFLGGEDFDQRVIDYLAEEFK
REQGIDLRKDKLALQRLKEAAEKAKIELSSSKETEINLPFITADASGPKHLVMKLTRAKL
ESLVDDLVERTLGPCRAALKDAGVTAGEIDEVILVGGMTRMPKVIETVKTFFGKEPARNV
NPDEVVAIGAAIQGAVLKGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQT
FSTADDNQTAVTIKVYQGEREMAADNKLLGNFDLTGIPPAPRGVPQIEVTFDIDANGIVS
VSAKDKATGKEQQIRIQASGGLSDTDIERMVKDAEANAAADKAKRELVDARNHADGLVHQ
TEKTLKDNEGKVSAQDKGEAEAAIAAVRSALEGSDLEAIKSATERLTQVAMRIGEAMYKA
QAEAGAAQPGAETAAPGDKVVDAEFEDVDDKKKSA
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggtcatcggtatcgacctcggcaccacgaattcctgcgtcgcgatcatggag
ggcaaggatgtccgcgtgatcgagaacagcgagggcgcgcgcacgacaccgtcgatggtc
gccttctccgagagcaacgagcgtctggtcggccagtccgccaagcgtcaggcggtcacc
aacccgacgaacacgctgtatgcggtcaagcgcctgatcggccgccgctatgacgatccc
accgtcgagaaggacaagggcctcgtctcctacaacatcgtccgcggcgacaatggcgat
gcctgggtcgagtcgcgcggccagcgctacgcgccgagccagatctcgtccttcgtgctg
accaagatgaaggaaaccgccgaggcctatctcggcgaagccgtgacccaggcggtcatc
accgtcccggcctacttcaacgacgcccagcgccaggccaccaaggacgccggcaagatc
gccgggctcgaggtgctgcgcatcatcaacgaaccgacggcggcggctctcgcctacggc
atggacaagaagcagggcggcacgatcgcggtctacgacctcggcggcggcacgttcgac
atctcgatcctcgaactgggcgacggcgtgttcgaggtgaagtccaccaacggcgacacc
ttcctcggcggcgaggatttcgaccagcgcgtgatcgactacctggccgaggagttcaag
cgcgagcagggcatcgacctgcgcaaggacaagctcgccctccagcgcctgaaggaagcc
gctgaaaaggcgaagatcgagctgtcctcctcgaaggagaccgagatcaacctgcccttc
atcaccgccgacgcctcggggccgaagcatctcgtgatgaagctgacccgtgccaagctc
gaaagcctcgtggatgatctggtcgagcgcacgctcggcccgtgccgcgcggcgctgaag
gatgccggtgtcaccgccggcgagatcgacgaggtgatcctggtcggcggcatgacccgc
atgcccaaggtcatcgagacggtgaagaccttcttcggcaaggaacccgcccgcaacgtc
aaccccgacgaggtggtcgccatcggcgccgccatccagggcgcggtgctcaagggcgac
gtcaaggacgtcctcctgctcgacgtcaccccgctctcgctcggcatcgagacgctgggc
ggcgtgttcacccgcctgatcgaccgcaacaccacgatcccgaccaagaagagccagacc
ttctccaccgccgacgacaaccagaccgccgtgaccatcaaggtctaccagggcgagcgc
gagatggcggcggacaacaagctgctcggcaatttcgacctgaccggcattcccccggcc
ccgcgcggggtgccgcagatcgaggtcaccttcgacatcgacgccaacggcatcgtgtcc
gtctcggcgaaggacaaggcgaccggcaaggagcagcagatccgcatccaggcctccggc
ggcctgtcggacaccgatatcgagcgcatggtgaaggacgccgaggcgaacgccgcggcc
gacaaggccaagcgcgagctggtcgatgcccgcaaccatgccgacggcctcgtccaccag
accgagaagacgctgaaggacaacgagggcaaggtctccgcccaggacaagggcgaggcc
gaggcggcgatcgccgcggtgcgctccgcgctggaaggcagcgatctcgaggcgattaag
tcggccaccgagcggctgacccaggtcgccatgcggattggcgaggcgatgtacaaggcg
caggccgaggccggtgccgcccagccgggcgccgagacggccgcgccgggcgacaaggtg
gtcgacgccgaattcgaggatgtcgacgacaagaagaagtccgcgtga

DBGET integrated database retrieval system