KEGG   Acidiphilium cryptum: Acry_1880Help
Entry
Acry_1880         CDS       T00527                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
acr  Acidiphilium cryptum
Pathway
acr00020  Citrate cycle (TCA cycle)
acr00190  Oxidative phosphorylation
acr00650  Butanoate metabolism
acr01100  Metabolic pathways
acr01110  Biosynthesis of secondary metabolites
acr01120  Microbial metabolism in diverse environments
acr01130  Biosynthesis of antibiotics
acr01200  Carbon metabolism
Module
acr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acry_1880
   00650 Butanoate metabolism
    Acry_1880
  Energy metabolism
   00190 Oxidative phosphorylation
    Acry_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF4271
Motif
Other DBs
NCBI-ProteinID: ABQ31082
UniProt: A5FZQ0
Position
2071606..2071983
Genome map
AA seq 125 aa AA seqDB search
MRIMRSALGRARGMGAAKSGVHHWWAQRLTALALLPLALYAVLSVLLLEGASQAEMLRYM
AEPWNGVLFLALVIALFYHLQLGLQVVIEDYIRSEGKRLAVMLAMRATAGFFGLLAIISV
LKLSF
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcatgcgttcggcactcggccgcgcccgcggcatgggggccgcgaaatcgggc
gtgcatcactggtgggcgcagcggctgaccgcgctggcgctgctgccgctcgcgctctac
gccgtgctgtcggtgctgctgctggagggcgcgagccaggccgagatgctgcgctacatg
gccgagccgtggaacggggtgctgttcctcgccctcgtgatcgcgctgttctatcacctg
cagctgggtttgcaggtggtgatcgaggactacatccgctccgagggcaagcggctcgcg
gtcatgctcgcgatgcgggcgacggccgggttcttcgggctgctggccatcatctcggtc
ctgaaactgtccttctga

DBGET integrated database retrieval system