KEGG   Acidiphilium cryptum: Acry_2025Help
Entry
Acry_2025         CDS       T00527                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
acr  Acidiphilium cryptum
Pathway
acr00270  Cysteine and methionine metabolism
acr00480  Glutathione metabolism
acr01100  Metabolic pathways
Module
acr_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:acr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Acry_2025
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Acry_2025
Enzymes [BR:acr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Acry_2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABQ31225
UniProt: A5G043
Position
2220910..2221863
Genome map
AA seq 317 aa AA seqDB search
MSGLRVAVQMDPMESVDIDGDSTFVLMLEAQRRGHALWHYTVRDMWLENGALNARLRPVT
VRREAGNHFAFGPAETMDLAAMDVVLMRQDPPFDMGYITATHLLEHIHPRTLVVNDPAAV
RNAPEKLLVTDFPDLMPPTLIAWDRTAIREFRARHKDIIVKPLYGNGGMGIFRIKPDDEN
LGALLDTHFAGSREPLMVQRYEPAVRAGDKRIILIDGEPLGAINRVPAEGDARSNMHAGG
IAEPTEMTARDREICARIGPTLKERGLLFAGIDVIGDYLTEINVTSPTGLQQVARFNGLH
LEATIWDRIEARRASGH
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtttgcgggtcgcggtccagatggatccgatggaaagcgtcgatatcgacggt
gattcgacctttgttctgatgctcgaggcacaacgccggggccatgcgctctggcactat
accgtgcgcgacatgtggctcgagaacggcgcgctcaacgcgcggctccggccggtgacg
gtgcggcgcgaagccggcaaccacttcgcgttcggccccgcggaaacgatggatctcgcg
gcgatggacgtggtgctgatgcgccaggatccaccgttcgacatgggctacatcacggcg
acgcacctgctcgagcacatccatccgcggacgctcgtcgtcaacgatcccgccgcggtg
cgcaacgcaccggaaaagctgctggtgacggactttccggacctgatgccgcccacgctg
attgcctgggaccgcaccgccatccgcgaattccgcgcccgtcacaaggacatcatcgtc
aagccgctctacggcaatggcggcatgggcatcttccgcatcaagccggatgacgagaat
ctcggcgccctgctcgacacgcatttcgccggttcgcgcgaaccgctgatggtgcagcgc
tacgagccggccgtgcgggccggcgacaagcggatcatcctgatcgatggcgagccgctg
ggcgcgatcaaccgtgtgccggcggagggagacgcccgatccaacatgcacgcgggcggc
atcgccgaacccaccgaaatgacggcgcgcgaccgtgagatctgcgcgcggatcggaccg
acgctcaaggagcgcggactgctttttgccgggatcgacgtgatcggcgactacctgacc
gagatcaacgtcacctccccgaccgggctgcaacaggtcgcgcgcttcaacggcctgcat
ctggaagcaacgatctgggatcgcatcgaggctcgccgagcttctggccactga

DBGET integrated database retrieval system