KEGG   Acidiphilium cryptum: Acry_2091Help
Entry
Acry_2091         CDS       T00527                                 

Definition
(GenBank) Uncharacterized protein-like protein
  KO
K11906  type VI secretion system protein VasD
Organism
acr  Acidiphilium cryptum
Pathway
acr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Acry_2091
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acr02044]
    Acry_2091
Secretion system [BR:acr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Acry_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: ABQ31290
UniProt: A5G0A8
Position
complement(2304353..2304823)
Genome map
AA seq 156 aa AA seqDB search
MKRRSIILALPVLLAGCGTPPPKPPAVLSLTITGGANQNPDASGTAEPVAVRVYPLVTAG
KFNAADPYSLLGKATSLLGSDLAGPSEQTIVAPGATVKLTHKLPDQAQSIGIAVFFRAID
RATWRLVAPVKAHETNALTLRIDGLDAKLVPTKPKG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgccgttcgatcatcctcgcacttcctgtcctccttgccggctgcggcacgccg
ccgccgaagccgccggcggtgctgtcgctgaccatcacgggcggggccaaccagaacccc
gatgcctcgggcactgccgagccggtggccgtgcgggtctacccgctggtcaccgccggc
aagttcaatgccgccgacccgtattcgttgctcggcaaggccacgtccctgctcggcagc
gacctcgccggtccgtcggagcagacgatcgtcgcgcccggcgccacggtgaagctgacg
cacaaattgccggatcaggcgcagtcgatcggcatcgccgtgttcttccgggcgatcgac
cgggcgacatggcgcctcgtcgcgccggtgaaggcgcatgaaacgaacgcgctgaccttg
cggatcgacggattggacgccaagctcgtcccaaccaaaccgaagggctga

DBGET integrated database retrieval system