KEGG   Acidiphilium cryptum: Acry_2092
Entry
Acry_2092         CDS       T00527                                 

Definition
(GenBank) putative FHA domain containing protein
  KO
K11894  type VI secretion system protein ImpI
Organism
acr  Acidiphilium cryptum
Brite
KEGG Orthology (KO) [BR:acr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acr02044]
    Acry_2092
Secretion system [BR:acr02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Acry_2092
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: ABQ31291
UniProt: A5G0A9
Position
complement(2304820..2306211)
AA seq 463 aa
MTLTLSVLRCPDAAPPETRSIEGGEFRIGRGPDNDWVLTDPDRVLSKRHCVIAWRAGAWQ
IADTSTNGTFVNQDIEPLGAGRVHALSDGDRIRLGSYEIEARLVERGFGDAGYGGGFGAA
PATRPDPFADPFGEDPFAKPAAPVSSPVSDEWFGGGNSISMPDDFAGLPDDDALFGPTPV
PDHSPAQNDVFRPAPMAPKLLPDDWDLGLEPGANTASAGPAWTAPSPLPPPAEIQPPPPA
APAPPAPLPPAPLPPAPVPAAPVPAGAPGGDLLRIFLEAAGMDGLPPPADPELLMRRLAG
LFRAMVGGLRQVMIARAAIKGEFRIEQTMIRARGNNPLKFSADDDDAMAALIGLGRRTSD
LQAEEAVRDALRDIRLHEIAVMSGMQAAVRALFARLDPAPLRAEAESARALLPAQRKARA
FEAYETLYGQLSAALADDFDNVFGKTFARAYERALSDAEASET
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgaccctcaccctcagcgtgctccgctgcccggatgccgccccgccggaaacccgcagc
atcgagggcggggaattccgcatcggccgcggtccggacaatgactgggtgctcaccgat
cccgatcgcgtgctgtccaagcggcattgcgtgatcgcctggcgtgccggcgcctggcag
atcgccgacaccagcaccaacggcacattcgtcaatcaggacatcgagccgcttggcgcc
ggccgcgttcacgcgctgagcgacggcgaccggatccggctgggcagctacgaaatcgaa
gcccgtctcgtcgagcgcggcttcggggatgcgggatatggcggtggtttcggcgccgcg
cccgcgacccggccggaccccttcgccgatccgttcggcgaggacccgttcgccaaaccc
gcggcacccgtctcctctcccgtatccgacgagtggttcggcggcggcaattcgatttcg
atgcccgacgactttgccggcctgccggatgacgatgccctgttcggcccgacgccggtg
cccgaccactcgccggcgcagaacgacgtcttccgccccgcgccgatggcgccgaaactt
ctgcccgatgactgggatctgggcctcgaacccggcgccaacacggcgtcggccggcccg
gcatggacggcgccttcgccgctgccgccgcccgccgagatccagccgcctccaccggcc
gctccggcgccgcccgctcccctgccgcccgctcccctgccgcccgcccccgtgccggcc
gctcccgtgccggccggcgcgcccggcggcgatctgctcaggatctttctcgaggccgcg
ggcatggacgggctgccgccgccggcggatccggaactgctgatgcgtcgcctcgccggt
ctgttccgcgccatggtgggcgggctgcgccaggtgatgatcgcccgcgccgcgatcaag
ggcgaattccggatcgaacagacgatgatccgcgcgcgcggcaacaacccgctcaaattc
tcggcggatgacgacgatgcgatggccgcgctgatcggcctcggccgccgcaccagcgac
ctgcaggccgaggaggcggtgcgggacgcgctgcgcgatatccgcctgcacgagatcgcg
gtgatgagcggcatgcaggccgcggtgcgcgccctgttcgcccggctcgatcccgcgccg
ctgcgggcggaggccgaatcggcgcgcgcgctgctgccggcccagcgcaaggcgcgcgcc
ttcgaggcctatgaaacattgtatggccagctcagcgcggcccttgccgacgatttcgac
aacgtcttcggcaagacctttgcccgcgcctacgagcgcgccctgtcggatgcggaggcc
agtgaaacgtga

DBGET integrated database retrieval system