KEGG   Acidiphilium cryptum: Acry_2397Help
Entry
Acry_2397         CDS       T00527                                 

Definition
(GenBank) Propanoyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acr  Acidiphilium cryptum
Pathway
acr00071  Fatty acid degradation
acr00072  Synthesis and degradation of ketone bodies
acr00280  Valine, leucine and isoleucine degradation
acr00310  Lysine degradation
acr00362  Benzoate degradation
acr00380  Tryptophan metabolism
acr00620  Pyruvate metabolism
acr00630  Glyoxylate and dicarboxylate metabolism
acr00640  Propanoate metabolism
acr00650  Butanoate metabolism
acr00900  Terpenoid backbone biosynthesis
acr01100  Metabolic pathways
acr01110  Biosynthesis of secondary metabolites
acr01120  Microbial metabolism in diverse environments
acr01130  Biosynthesis of antibiotics
acr01200  Carbon metabolism
acr01212  Fatty acid metabolism
acr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acry_2397
   00630 Glyoxylate and dicarboxylate metabolism
    Acry_2397
   00640 Propanoate metabolism
    Acry_2397
   00650 Butanoate metabolism
    Acry_2397
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Acry_2397
   00072 Synthesis and degradation of ketone bodies
    Acry_2397
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Acry_2397
   00310 Lysine degradation
    Acry_2397
   00380 Tryptophan metabolism
    Acry_2397
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acry_2397
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Acry_2397
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Acry_2397
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acr04147]
    Acry_2397
Enzymes [BR:acr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Acry_2397
Exosome [BR:acr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acry_2397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABQ31591
UniProt: A5G159
Position
2642922..2644091
Genome map
AA seq 389 aa AA seqDB search
MTSTAIAGWAHTRFGKSDSPDLEDLLAEAATGAIAHAGIDPNEIDAVFVGNFNNGFTRQD
FPSSLPMQAVPELRFKPATRYENACASGSAAIHAARDFIAAGRGRIALVLGGEKMTACPK
EQVGENLLGACYRREEGDIQAGFAGVFGRIAESYFQRFGDQSDALAAIAAKNHRNGVDNP
YAQMRRDLGFEFCRRESEKNPIVAGPLKRTDCSLVSDGAASLILTDEDTARALPQAVRFR
AAAHVNDFLPLSRRDPTRFEAGERAWAQALAAAGLTLDDLSFVETHDCFTIAELIEYEAM
GLVPRGQGARAVLEGITAPDGRLPVNRSGGLKSKGHPVGATGVSMHVMAAMQLTGTAGDM
QLPRADLAGIYNMGGAGVANYVSILDRLN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccgccatcgccggctgggcgcacacgcgtttcggcaaatccgacagcccc
gatctcgaggatctcctggccgaggccgccaccggcgccatcgcccatgccgggatcgac
ccgaacgagatcgacgccgtcttcgtcggcaatttcaacaacggcttcaccaggcaggat
ttcccctcctcgctgccgatgcaggccgtccccgaactccgcttcaagccggcgacgcgt
tacgagaacgcctgcgcctccggctccgccgccatccatgcggcgcgggatttcatcgcc
gccggccgcggccgcatcgcgctggttctcggcggtgagaagatgaccgcctgccccaag
gagcaggtcggcgaaaacctcctcggcgcctgctaccggcgcgaggagggcgacatccag
gccgggttcgccggtgtgttcggccgcatcgccgagagctatttccagcgcttcggcgac
cagtccgacgcgctggccgccatcgccgcgaagaaccaccgcaacggggtcgacaatccc
tacgcgcagatgcgccgcgatctcggcttcgagttctgccgccgtgaatcggaaaaaaat
cctatcgtcgccggcccgttgaagcgcaccgactgctcgctggtcagcgacggcgccgcg
tccctcattctgaccgacgaggacaccgcccgcgccttgccgcaggccgtgcgtttccgg
gccgccgcccatgtgaatgatttcctaccgctctcccgccgcgacccgacaaggttcgaa
gccggcgaacgcgcctgggcgcaggcgctcgccgccgccggcctcacgctggacgacctg
tccttcgtcgagacgcatgactgcttcaccatcgccgagctgatcgaatacgaggcgatg
ggcctcgtcccgcgcggccagggggcgcgcgccgtgctggagggcatcaccgcgccggat
ggaaggctgccggtcaaccgctccggcgggctgaaatccaagggccacccggtcggcgcc
accggtgtctcgatgcatgtgatggcggcgatgcagctcaccggcaccgccggcgacatg
cagctcccccgcgccgacctcgccggcatctacaacatgggcggcgccggggtcgccaac
tacgtctcgatcctcgaccgcctgaactga

DBGET integrated database retrieval system