KEGG   Acidiphilium cryptum: Acry_2603Help
Entry
Acry_2603         CDS       T00527                                 

Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
acr  Acidiphilium cryptum
Pathway
acr00030  Pentose phosphate pathway
acr01100  Metabolic pathways
acr01120  Microbial metabolism in diverse environments
acr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acry_2603
Enzymes [BR:acr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Acry_2603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABQ31794
UniProt: A5G1R2
Position
2857789..2858607
Genome map
AA seq 272 aa AA seqDB search
MTKADSAQGQAARFAGRFALVTGGASGIGRAIALRLAAEGASVTFTHLPGDDAAADTLAE
LRRAGPGASHHAEAADVADRAAMEAVAARAIARAGHLSLLVNNAGIQVEQPSDALDMDRF
DRVIAVDLLAVAHLSSRVIGHMAQRGSGAILNISSVHEIVPKPGFLSYSAAKGGIGNLTR
TLALEFAGRGVRVNAVGPGATVTPMNAGWTGDPERRRVVEAHIPMGRPAEAAEIAAVAAF
LLSDEASYVTGQTLYACGGLSLYGDFARNWST
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggcagattcggcacaagggcaggccgcgcgtttcgcgggccgcttcgccctc
gtcaccggcggggcgtccggcatcggccgggcgatcgcgttgcgccttgcggcggagggg
gcgtcggtcaccttcacccatctgcccggcgacgatgcggcggcggacacgctcgccgaa
ctccgccgcgccggccccggggccagccatcacgccgaggcggcggatgtcgccgaccgc
gccgcgatggaggcggtcgcggcgcgcgccatcgcgcgagccggccatctttcgctcctc
gtcaacaatgccggcatccaggtcgaacagccgagcgacgcgctcgacatggaccggttc
gaccgcgtcatcgcggtcgacctgctggccgtcgcccatctctcctcgcgggtcatcggc
catatggcgcagcgcgggtcgggcgcgatcctgaatatctcctcggttcacgaaatcgtg
ccaaagcccggcttcctgtcctattcggcggcgaagggcggcatcggcaacctcacccgc
acgctcgcgctcgaattcgccgggcgcggcgtgcgggtgaacgcggtcggtcccggcgcc
acggtcacgccgatgaacgccggctggaccggcgatcccgagcgccggcgcgtggtcgag
gcgcacatcccgatgggccgcccggccgaggccgcggaaatcgccgcggtcgccgccttc
ctgctgtcggacgaggcgagctacgtcaccggccagacgctctatgcctgcggcggcctg
tcgctctacggcgatttcgcgcgcaactggtcgacctga

DBGET integrated database retrieval system