KEGG   Acidiphilium cryptum: Acry_2661Help
Entry
Acry_2661         CDS       T00527                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
acr  Acidiphilium cryptum
Brite
KEGG Orthology (KO) [BR:acr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Acry_2661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 FbpC_C_terminal
Motif
Other DBs
NCBI-ProteinID: ABQ31852
UniProt: A5G1X0
Position
complement(2920614..2921087)
Genome map
AA seq 157 aa AA seqDB search
MKRGRNRPATTRRPRMTSHRPDPTGALFVNEDARIRVSIRAIFLEDQSRPEERHFVWAYQ
VRIENVGQVTAQLMMRTWTITDGNGHVQHVHGPGVVGEQPVLDPGDAFEYTSGTPLETPS
GFMTGIFHMVAVDSGEEFDVPTPGFSLDSPHADQRRH
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaggggccggaaccggcccgcaacgacgagacgtccacgcatgaccagccaccgc
cccgacccgaccggcgccctgttcgtcaacgaggatgcccgcatcagggtgagcatccgg
gcgatcttcctcgaggaccagtcccgtccggaggagcggcatttcgtctgggcgtatcag
gtgcggatcgagaatgtcggccaggtgacggcgcagctcatgatgcggacctggacgatc
accgacggcaacggccatgtccagcacgttcacggccccggcgtggtcggcgagcagccg
gtgctcgaccctggcgacgccttcgaatacacctccggcacgccgctggagacgccctcg
ggcttcatgaccgggatcttccacatggtggcggtggacagcggcgaggaattcgacgtg
ccgacgccgggcttcagcctcgacagcccgcacgcggaccagcggcggcactga

DBGET integrated database retrieval system