KEGG   Acidiphilium cryptum: Acry_2767Help
Entry
Acry_2767         CDS       T00527                                 

Definition
(GenBank) Formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
acr  Acidiphilium cryptum
Pathway
acr00670  One carbon pool by folate
acr01100  Metabolic pathways
acr01120  Microbial metabolism in diverse environments
acr01200  Carbon metabolism
Module
acr_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:acr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Acry_2767
Enzymes [BR:acr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Acry_2767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: ABQ31958
UniProt: A5G276
Position
complement(3029225..3030898)
Genome map
AA seq 557 aa AA seqDB search
MASDLDIARASRLRPIGEIAAAAGIPAEALIPYGRYKGKVDGGFIRSLEDRPDGALVLVV
GISPTPAGEGKTTTSIGLGDALRAAGAKAMIALREPSLGPCFGQKGGATGGGRAQVAPME
EINLHFTGDFHAITSANNLLAAMLDNHVYWGNELGIDPRRIAFRRAIDMNDRALRQTVLG
LGDGANGAAREQKFDITVASEVMAIFCLARDLDDLQRRLARIVVAERRDGSPVTPADLKA
VGAMAALLRDALQPNLVQTLEGTPALVHGGPFANIAHGCNSVIATRTALKLADIVVTEAG
FGADLGGEKFLDIKCRQAGLAPSCAVVVATIRALKMHAGVAKADLGAENPGAVARGAANL
RRHVAAMRAFGLPVIVAINGFVTDTGAEREALRAALDEDGGARICFCTHWADGSAGATDL
AQAVIETIAAKSARFAPLYPDDMKLPHKLRTIAQRIYGADDIELSPLAAKRLARFEAQGY
DHLPVCVAKTQYSFTADPARRGAPTGFTVPIRDARLSAGAGFVVALAGDVMTMPGLPRIP
AAEAIGLDPDGAIHGLF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggatctggacatcgcacgcgcttcacgcctgcgcccgatcggcgagattgcc
gccgccgccggcataccggccgaggcgctgatcccctatggccgctacaagggcaaggtg
gatggcggcttcatccgctcgctcgaagaccggccggacggcgcgctggtgctcgtcgtc
ggcatcagcccgacgcccgccggcgagggcaagacgacgacctcgatcggcctcggcgat
gcgctgcgcgccgccggcgcaaaggcgatgatcgccctgcgcgagccctcgctcggcccg
tgcttcggccagaagggcggggccaccggcggcggccgcgcccaggtcgcgccgatggag
gagatcaaccttcatttcaccggcgatttccacgccatcaccagcgccaacaacctgctc
gccgcgatgctcgacaaccatgtctactggggcaacgagcttggcatcgacccgcgccgg
atcgccttccgccgcgccatcgacatgaacgaccgcgccctgcgccagacggttctcggc
ctgggcgacggggcgaacggcgccgcccgcgagcagaaattcgacatcaccgtcgcctcc
gaggtgatggcgatcttctgcctcgcccgcgatctcgacgacctgcaacgccgcctcgcc
cgcatcgtcgtcgccgagcggcgcgacggctcgcccgtcaccccggccgatctcaaggcc
gtcggcgccatggccgccctgctgcgcgacgcgctgcaacccaacctggtgcagacgctg
gaaggcacgccggcactggtccatggcgggcccttcgccaacatcgcccatggctgcaac
tcggtcatcgccacccgcaccgcgctcaagctggccgacatcgtggtgaccgaggccggg
ttcggcgccgatctcggcggcgagaaattcctcgacatcaagtgccggcaggccgggctc
gcgccctcctgcgccgtcgtcgtcgcgacgatccgggcgctgaagatgcatgccggggtg
gccaaggccgatctcggcgccgagaatcccggcgcggtcgcgcgcggtgccgccaatctg
cgccgccacgtcgccgccatgcgcgccttcggcctgccggtgatcgtcgcgatcaacggc
ttcgtcaccgataccggggccgagcgcgaggccctgcgcgcagcactcgacgaggatggc
ggcgcgcggatctgcttctgcacccattgggccgatggcagcgccggcgccaccgacctc
gcgcaggcggtgatcgagacgatcgcggcgaaatccgcccgcttcgccccgctctacccg
gacgacatgaagctgccgcacaagctgcgcaccatcgcccagcgcatctacggcgccgac
gacatcgagctctcgccgctggcggccaaacgcctcgcccggttcgaggcgcagggatac
gaccacctgccggtctgcgtcgccaagacgcagtacagcttcaccgccgatccggcccgc
cgcggcgcgcccaccggcttcaccgtgccgatccgcgatgcccgcctctccgccggcgcc
ggcttcgtggtcgccctcgccggcgatgtcatgaccatgcccggcctgccgcgcatcccc
gccgccgaggcgatcgggctcgaccccgatggcgcgatccatggcctgttctga

DBGET integrated database retrieval system